(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE256

CAGLA1_12.PE256      Location/Qualifiers
FT   CDS_pept        622029..624704
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349244"
FT                   /locus_tag="CAGL0M05907g"
FT                   /product="Similar to uniprot|P36023 Saccharomyces
FT                   cerevisiae YKR064w"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62579.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG124075"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI00003B70DC"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJJ1"
FT                   /transl_table=1
FT                   /translation="MEEPKKVTKSRRRPMLVCVNCRKRKSKCDRQLPCSKCIQHGDTDT
FT                   CTYLNDVPIGKKNNVPNTQVTPNSSSPSIVINLHQNGNDYKTKNLNGQDNTLLKEINNN
FT                   IWGRNSPIFPDSSDHSPPTQVFGDGPNLKPKVIGHCRYSGENQYINMVPKGYLIEVKRS
FT                   SVTRYAMWTSTSVEYRDPYLSCMLMFKKGAVKATTEQMKKKMKFKNLPNSFALFTAFDN
FT                   ADDGKDKPNLNHAKIFNKFAEYRQQKSIGDLSEDHILDTKDLPRRQAVENCVLMFAKFH
FT                   LCPLLPLFNLPHLMEEVKIFYDNVEKTGKVSTKNGDNWIYCIILLLTKICKLAICMSNI
FT                   PGDDVSPIAQLDTTRFIPLVHKYIMNHNLFRKCTLHQLQVLLLLRFYNWCAPEDGDGQQ
FT                   GQQNSILMGMIISSAKELGIGWDLFTPGFPVGIDISDGSRPSAQHMNAEEYTTLYQKIW
FT                   CYILFWDRKMLLVNGQNCIIQRSRDTDYSLLEATFSKEDGSEFFRYFIHLDSLLLEIND
FT                   LISSNPTKVNITALNNCMTSLEEEFRNIHTIVNSREILQSNDDPRFFEVSWNIKIARAC
FT                   ILHAEVVSYEKECDFVRCHYAIQKLWEIVLSMCSDCMEYWSQRSEAFLGSLNNFYTNRI
FT                   VEIAADRLVHFVKAIILRLHRFHNVKAEDKQILVQFMHKFCSLYFTNFGREYFRCFKSL
FT                   FNLKMDYRVLSYSSVKDPWTVMLTFILHEMSYGEQPEGKLSLRDRLPLIAKLHDKLSYM
FT                   PSSFKNHDLILDAWQTSIYPICRYDEHFQLNLYISEIKKLDEHYKIDKDKNLFESFYNN
FT                   EVKLFGEEFGTQESCNSAFQKDSSEPPQETITLDEWGTLSGPYEGNDILLASETDSKAL
FT                   RYNDQLIQEIFNPKDFLPFL"
     atggaagaac ccaagaaggt cacaaagtct aggcgccgtc ctatgctagt atgtgtgaac        60
     tgccgaaaac ggaagtctaa atgtgaccgc cagttaccat gcagtaagtg tatacaacac       120
     ggtgacacag atacatgtac atacttgaat gatgttccca taggcaagaa gaataatgtt       180
     cctaatactc aagtgactcc taacagttca agtcccagta tcgtgattaa tttacatcag       240
     aatggcaatg actataaaac aaaaaatttg aatggtcagg ataacaccct tctgaaagaa       300
     ataaataata atatatgggg tagaaatagc cccatatttc cagacagttc agatcattca       360
     cctccaacac aagtttttgg ggatggccct aatttaaaac ccaaagtaat tggccattgc       420
     agatactctg gcgaaaatca atatattaat atggtaccca agggttattt aatcgaagta       480
     aaaagatcat ccgtaactcg ttatgcaatg tggacaagca catcggtaga gtacagagat       540
     ccttacttaa gttgcatgct aatgttcaaa aaaggtgctg ttaaagccac tactgaacaa       600
     atgaagaaaa agatgaaatt taagaattta cctaattcat tcgccctatt cacagcattt       660
     gacaatgctg atgatggtaa agataagcct aacttgaacc atgcgaaaat atttaataag       720
     tttgctgaat ataggcagca aaaatcaatt ggagatctgt ctgaggatca tattctggat       780
     acaaaggatt tacctcgtag acaagctgtt gaaaactgcg tacttatgtt tgcaaaattc       840
     catctttgcc cattattacc gttatttaat cttcctcatt tgatggaaga ggtaaagata       900
     ttttatgaca atgttgaaaa aacaggtaaa gtatcaacaa aaaatggcga caattggata       960
     tactgtatta ttttgcttct aaccaaaatt tgtaagttag ccatatgtat gtctaacata      1020
     ccaggtgatg atgttagccc tatcgctcaa ttggatacca ccagatttat tcctctggta      1080
     cataaatata ttatgaatca taatttattt cgcaaatgca cattacacca gttgcaagtc      1140
     ttacttttgt taagatttta taattggtgt gcaccagaag atggcgatgg acaacaagga      1200
     caacagaata gtattctaat gggcatgatc atttccagtg caaaagaact cggtatagga      1260
     tgggatctat ttacccccgg atttcctgtt ggcatcgata tatcagatgg ttctagacct      1320
     tctgcacaac atatgaatgc tgaggagtat actacattat atcaaaaaat atggtgttat      1380
     attttatttt gggatagaaa aatgctattg gtaaatggtc aaaactgcat aatacaaaga      1440
     agtagagata ctgattattc actactcgag gcaactttta gtaaggaaga tggtagtgag      1500
     ttttttcgat actttattca tctagattcg ctacttctgg aaattaatga cctcatatct      1560
     tcaaatccca ctaaagtaaa tataacagct cttaataact gtatgacatc tcttgaagag      1620
     gaatttcgca atatccatac aatcgttaat tcaagagaaa tactgcaaag caatgatgat      1680
     ccaagatttt ttgaagttag ttggaatatc aagatagccc gtgcttgtat tttgcatgct      1740
     gaggtggtat catatgaaaa ggaatgtgat tttgtaagat gccattatgc aattcaaaaa      1800
     ttgtgggaaa ttgtcctatc gatgtgttcc gactgtatgg aatactggag ccagagatca      1860
     gaagcattcc ttggtagttt gaataacttt tataccaatc gtattgtcga gattgctgct      1920
     gacaggctcg tacattttgt gaaggcaatc attttgcggc tccatagatt tcataatgta      1980
     aaggctgaag ataagcagat actagttcag ttcatgcata agttctgttc cttatatttt      2040
     acaaactttg gtagggaata tttcagatgt ttcaaaagtt tgttcaattt gaagatggat      2100
     tatagagttc tttcatattc aagtgtaaaa gacccatgga ctgtcatgct gacattcatt      2160
     ttacatgaaa tgtcctacgg tgaacagccg gaaggtaagt tatcattaag agacagacta      2220
     ccattgattg ccaaattaca tgataagtta agctatatgc ccagctcttt taaaaaccat      2280
     gaccttatct tagatgcttg gcagacgtct atttatccaa tttgccggta tgatgagcac      2340
     ttccaactta acctatacat tagtgaaatt aaaaagctag acgaacatta caaaatagat      2400
     aaggataaaa atttatttga gtcgttctac aacaacgaag taaaactatt tggtgaggaa      2460
     tttggaactc aagaaagctg taattctgct tttcaaaaag attcatctga acctcctcaa      2520
     gaaactatta cactagatga atggggtacc ctttcgggac cttatgaagg taatgatata      2580
     ttgttggcat cagaaactga ttcaaaggcg ttaagatata atgatcagct aatccaagaa      2640
     atattcaatc caaaagactt tcttccattc ctatga                                2676
//

If you have problems or comments...

PBIL Back to PBIL home page