(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE259

CAGLA1_12.PE259      Location/Qualifiers
FT   CDS_pept        627289..628521
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000171827" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438963"
FT                   /locus_tag="CAGL0M05973g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="nucleosome assembly"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62582.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006334"
FT                   /db_xref="HOGENOM:HBG390350"
FT                   /db_xref="HOGENOM:HBG619916"
FT                   /db_xref="InterPro:IPR002164"
FT                   /db_xref="UniParc:UPI00003B70DF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJI8"
FT                   /transl_table=1
FT                   /translation="MSAPIKTKPKSSMKIDNAPTPHNTPASVLNNSYLKNGNPVGKSKP
FT                   PPTISEEDIQTALSSQQPLLLGAIQEKLGSLVGQDSGYVDSLPQVVRNRIFALKKLQSD
FT                   LFGIEKDFQVELFELEHKYLQKYAPLHARRSEIISGKQEPTSEEVAAGKEIQEKEEGEE
FT                   EEGEKPTDIQLTEEDIKGIPSFWLTALENLPIVSDTITDRDAEVLEYLQDVSIEYLTEG
FT                   KPGFLLKFKFSEENPYFKTPELTKTYYYQSELGYSGDFIYDHADGCSIDWVDNDSNVTI
FT                   AVEMRKQRNKTTKQVRTIEKITPIESFFNFFDPPKMAGDEEDEEDLEDLEERLALDYSI
FT                   GEQIKDKLIPRAVDWFTGAALEFEFNDAPEDEFDEFEDEDEDEDEDEEEDEDERDDFAN
FT                   KKEEPPECKQS"
     atgtcggcac caattaagac taagccaaag tcttctatga agatagacaa tgctcctaca        60
     ccacacaaca cacctgccag tgtgctgaat aacagctact tgaagaacgg caatccagtg       120
     ggcaagagca agcctccacc aacgattagc gaggaagata ttcaaactgc gttgagttcg       180
     cagcagccac tattgctcgg tgcaatccag gaaaagctgg ggtctcttgt aggccaggat       240
     agtggatacg ttgattcttt gccacaggta gttagaaata gaatatttgc tctaaagaag       300
     ctgcaatccg atctgtttgg tattgagaag gacttccaag tggaattatt cgagttggag       360
     cacaagtact tacaaaaata cgcgcctcta catgcccgtc gtagcgagat cattagtggt       420
     aagcaagaac caacctctga agaagttgct gcaggtaaag aaattcaaga aaaggaagaa       480
     ggtgaagaag aagaaggtga aaagccaact gacattcaac taacggagga agacatcaag       540
     ggcattccat cattctggct cactgctctg gaaaacttgc caattgtctc agacacaatc       600
     actgatcgtg atgctgaagt gcttgaatat ttgcaagatg tcagcatcga atatctaact       660
     gaaggcaagc caggtttcct tctgaagttc aaattcagtg aggaaaaccc atacttcaag       720
     accccagaac taactaagac atactactac caaagtgagc ttggttactc tggtgatttc       780
     atctatgatc atgcagatgg ctgttctatt gactgggtag acaacgactc caatgttacc       840
     attgccgttg agatgcgcaa acagagaaac aagaccacaa agcaagtgcg tacgatagag       900
     aagatcacgc cgattgaatc attcttcaac ttcttcgacc caccaaagat ggccggcgat       960
     gaagaagacg aagaagacct ggaagacctg gaagaaagac tagcgctaga ctattccatc      1020
     ggtgaacaaa taaaggacaa actaattcct cgtgctgtag attggtttac tggtgcagca      1080
     ttggaatttg agttcaacga cgcaccagaa gatgaattcg atgaattcga agatgaggac      1140
     gaggacgagg atgaagatga agaagaagac gaggatgaaa gagacgactt cgcaaataag      1200
     aaagaagaac ctcctgagtg caaacaatct taa                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page