(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE26

CAGLA1_12.PE26       Location/Qualifiers
FT   CDS_pept        complement(79782..81101)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000142328" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436689"
FT                   /locus_tag="CAGL0M00682g"
FT                   /product="Similar to uniprot|Q06204 Saccharomyces
FT                   cerevisiae YLR446w"
FT                   /function="ATP binding"
FT                   /function="kinase activity"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /biological_process="glycolysis"
FT                   /protein_id="CAG62351.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG059104"
FT                   /db_xref="HOGENOM:HBG202599"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="InterPro:IPR022672"
FT                   /db_xref="UniParc:UPI00003B6FFA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK69"
FT                   /transl_table=1
FT                   /translation="MRPIGTMTIANPEKILEEVKSQLGVRQSLATITEKFQEELDFMLK
FT                   NCKKSMLPFPQVCCRGWSEYNEPMDMLAIDFGGSVLKFAVINMPQCQMELKYELEIKSK
FT                   VVDFKFFDNIVEWICNRIPINNERSLPRKFIVAITFSFPVNANNEIVAMGKGFRMSPEL
FT                   KGISILDILKQSFDRLEKEYSSSFTFEISNVINDSLAVHMTSKYLQSDNNDKISLILGT
FT                   GVNSCFEVQYEDLPQFKKDILTQFSDDYREKVLINSEMGFLGRYSKSIEFGNFDTNIDD
FT                   KMPLESITSGKWIPQILHNIIRYYNLLPMVGDEEIKYDGRLICEILSDGECPSEYLLSL
FT                   WDYEVYQIIRQITKLLINRAAIYLVAAIIAIRKFVSPEIYFTKGGIDIDYVGSFLNYCQ
FT                   YYQERIHLHSKGMVKLQFLNDSNLYGCAITAYSNIFENRI"
     atgagaccga ttgggacaat gacaatagct aatccggaaa agatcttaga agaggtcaag        60
     agccaacttg gagtgcgcca gtctttagct acaataactg agaaatttca agaggagctt       120
     gatttcatgt tgaagaattg taagaagtct atgttacctt tcccacaggt ttgttgccga       180
     ggatggtctg agtataatga gcctatggac atgcttgcca ttgattttgg aggaagtgtt       240
     cttaagtttg ctgtgattaa tatgccccag tgccaaatgg agctaaaata tgagttggag       300
     attaaatcaa aggtagttga tttcaaattt tttgacaata tagtggaatg gatatgcaat       360
     cgtattccaa taaacaacga aagaagtcta cctagaaaat ttatagtcgc tattacattc       420
     agtttcccag taaatgctaa caacgaaatt gtagccatgg gaaaaggatt taggatgtca       480
     ccagaactga aaggcattag tatattagat atcttgaaac aatcttttga tcgattagaa       540
     aaggagtaca gttcatcatt tacttttgag ataagcaatg taattaatga ctcattggcg       600
     gttcatatga catctaaata tcttcaaagt gacaacaacg ataaaatctc tttgatatta       660
     ggaactggtg tgaattcctg ctttgaagta caatacgaag atttgcctca gttcaaaaag       720
     gatattttaa cgcagttttc agatgattat agagaaaaag ttcttatcaa ttcagaaatg       780
     ggattcttgg gaaggtattc caaatccatt gagttcggca actttgacac taatatagac       840
     gataaaatgc ccttagaatc cataacatct ggtaaatgga taccacaaat actacacaat       900
     ataataagat attacaacct tttgccaatg gtcggagatg aggaaataaa atatgatgga       960
     agactaatat gcgaaatatt atctgacggt gaatgccctt cagagtacct tttgtctttg      1020
     tgggattatg aagtatacca aattataagg caaataacaa aactgctaat caatagggct      1080
     gctatatacc ttgtggcagc aatcattgcc ataagaaaat tcgttagccc cgaaatatat      1140
     tttacaaagg gtggaataga tatagactat gtgggcagtt ttttgaacta ttgtcagtac      1200
     taccaagaaa gaatacacct ccattccaaa gggatggtga aactgcaatt tcttaacgat      1260
     agtaaccttt atggatgcgc gattacagct tatagtaaca tctttgagaa tcggatatga      1320
//

If you have problems or comments...

PBIL Back to PBIL home page