(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE261

CAGLA1_12.PE261      Location/Qualifiers
FT   CDS_pept        complement(630670..632010)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000163305" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438965"
FT                   /locus_tag="CAGL0M06017g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="binding"
FT                   /function="prephenate dehydrogenase (NADP+) activity "
FT                   /biological_process="tyrosine biosynthetic process "
FT                   /protein_id="CAG62584.1"
FT                   /db_xref="GO:0004665"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006571"
FT                   /db_xref="HOGENOM:HBG053009"
FT                   /db_xref="HOGENOM:HBG330953"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012385"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00003B70E1"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJI6"
FT                   /transl_table=1
FT                   /translation="MMEEQWQANKVIGIIGLGDMGLLYATKFSSAGWKVVACDREELFD
FT                   SLSERKRQNAWKFDIVKNGHYVSRISDYIIYSVEAENIDKLVKLYGPSTKVGAIVGGQT
FT                   SCKTPEIKAFEKYLPEDVEIITLHSLHGPKVNTEGQPLVLINHRSKTDESMKFIESLVS
FT                   CLKSKQVYLTYEEHDRITADTQAVTHAAFLSMGRAWAKLKVYPWTLGVNKWYGGLENVK
FT                   VNISLRIYSNKWHVYAGLALTNPMAHKQILQYATSATELFTLFLDKKKDELTERLNKAK
FT                   EFVFGNHTGLLLLDDTIFEKYSLSKDSASSDSKESTSLPNSHLSLLAIVDSWHQLGINP
FT                   YDHMICSTPLFRIFLGVSEFLFLSPDLLEKTIDAAIDDHSFRRDDLEFVVAAREWSSIV
FT                   TFGNFDLYKRQFEDVQKFFEPMLPEANQIGNEMIKTILMHSQDSKEA"
     atgatggaag aacaatggca ggccaataag gtaattggta ttattgggct gggtgatatg        60
     ggtctgctat atgcaaccaa gttttccagt gctggttgga aagtggttgc ttgtgataga       120
     gaagagttat ttgattcgct ttcggaaagg aaaagacaaa atgcctggaa atttgatatt       180
     gtgaaaaatg gtcattatgt ttcaagaatc agtgattata ttatttacag tgtcgaagcc       240
     gagaacattg ataaattggt gaaattgtat gggccatcga ctaaagttgg tgccattgta       300
     ggtggtcaaa caagttgtaa gactcctgaa atcaaagctt tcgagaaata cctacctgaa       360
     gatgttgaaa ttataacttt gcactcctta catgggccaa aagtgaatac agagggtcag       420
     ccactggtct tgattaatca caggagcaag acagacgaat ctatgaagtt tatcgagtct       480
     ctggtgtctt gtctcaaaag taaacaggtc tatttgacct atgaagaaca cgatagaatt       540
     acagctgata ctcaagcagt gacacatgct gccttcttaa gtatgggtag ggcatgggca       600
     aaactaaaag tttatccatg gacattgggt gttaacaaat ggtatggtgg cttggagaat       660
     gtcaaagtta atatttcctt gagaatctat tcaaataagt ggcatgttta tgctggttta       720
     gcacttacaa acccaatggc ccacaaacaa attctgcaat acgcaacaag tgctacagaa       780
     ctgtttacat tatttttaga taagaaaaag gatgaactta cagagagatt aaacaaagca       840
     aaagaatttg tgtttggaaa tcatactggt ttattacttc ttgacgatac gatctttgag       900
     aaatattcat tatccaaaga ttctgcatct tctgatagca aagaaagtac ttctttgcca       960
     aattcacatc tgtcattgct ggctattgtt gactcgtggc atcagctggg aatcaatcca      1020
     tatgatcata tgatctgttc cacaccacta tttagaatat ttcttggtgt ttccgaattc      1080
     ctattcctat caccagacct attagaaaaa accattgatg ctgccattga tgaccactca      1140
     tttagaaggg atgaccttga gtttgtagta gccgctagag aatggagttc aattgtaaca      1200
     ttcggaaatt ttgacttata taaaagacaa tttgaagatg ttcaaaaatt ctttgaaccg      1260
     atgcttcctg aagctaacca aataggtaac gaaatgatca aaacaatctt aatgcactct      1320
     caggactcta aagaggcttg a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page