(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE262

CAGLA1_12.PE262      Location/Qualifiers
FT   CDS_pept        complement(632430..632798)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248080" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438966"
FT                   /locus_tag="CAGL0M06039g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="nucleic acid binding"
FT                   /protein_id="CAG62585.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="HOGENOM:HBG060005"
FT                   /db_xref="HOGENOM:HBG397189"
FT                   /db_xref="InterPro:IPR002775"
FT                   /db_xref="InterPro:IPR020241"
FT                   /db_xref="UniParc:UPI00003B70E2"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJI5"
FT                   /transl_table=1
FT                   /translation="MAEKLVRKLPTVKTMSHKKIKSTMYVKSGTPFKSATKRIDKLLNQ
FT                   CQRYVTVLGMGHSVTKTLAIATTYQEKLHKVQVMTKTIEVLDEVVEDTESIDDSDSDIE
FT                   TKLKKRLLSGVEVRIFKV"
     atggcagaga aattagttag aaagctaccg acggtaaaga ccatgtcaca caaaaagatt        60
     aaatcaacaa tgtatgtgaa gagtggaacg cccttcaaaa gtgctacaaa gaggatagac       120
     aagcttttaa accagtgtca acgatatgtt actgtactag gaatgggtca cagtgttacc       180
     aaaactcttg ccattgcaac cacatatcag gaaaagctgc acaaggtaca ggtaatgacc       240
     aagactattg aagtattaga tgaggtagta gaagacacag aaagcataga tgatagtgat       300
     agtgatatag aaactaaact caagaagcga ttattgagcg gtgtagaagt gaggatattt       360
     aaagtatga                                                               369
//

If you have problems or comments...

PBIL Back to PBIL home page