(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE266

CAGLA1_12.PE266      Location/Qualifiers
FT   CDS_pept        640057..640749
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000728" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349245"
FT                   /locus_tag="CAGL0M06127g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62589.1"
FT                   /db_xref="HOGENOM:HBG060002"
FT                   /db_xref="HOGENOM:HBG396992"
FT                   /db_xref="InterPro:IPR018624"
FT                   /db_xref="UniParc:UPI00003B70E6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJI1"
FT                   /transl_table=1
FT                   /translation="MDQEFFNATDFNGTNGTQFENNGTRFDNGTHGNGTFFEEPQVEMK
FT                   AVSFYTPLLYVSLLVISLFIFASQYRKNKIKKISELPSIFDESDAKDLYMDLLKLQKSG
FT                   DKKIHEKVLKAGLLNRCAEAIRRSLKLKEMAPQVEILYKNGSIGDDYWQRYQTEVKLVD
FT                   VEFKECIQESERLQPGWVPTFVPLAREICLNQALSRRYNAIATRREVCIEEWGLKLDKD
FT                   GKLISSKN"
     atggatcaag agtttttcaa cgccacggat ttcaatggca ccaatggcac tcaatttgag        60
     aataatggta cgcgttttga caacggaacc catggtaatg gtaccttttt tgaagagcca       120
     caagttgaga tgaaggcagt ttccttttac acacctttgt tgtacgtgtc gcttctggtt       180
     atctcgctat ttatatttgc atcacaatac aggaaaaata agattaagaa gatcagtgaa       240
     ctaccatcta tatttgacga gagtgacgcc aaggatctgt atatggatct gctgaagtta       300
     caaaaatctg gtgacaagaa gattcacgaa aaggttctga aggctggtct actgaaccgt       360
     tgtgctgagg ctatcagaag atccttaaaa ctaaaagaaa tggctccaca agttgaaatt       420
     ctttataaaa acgggtccat tggtgatgac tactggcagc gttaccaaac tgaggttaaa       480
     ctggtagatg ttgaattcaa agaatgtata caggaatcgg aaaggctgca gcctggctgg       540
     gttccaacat tcgtgccatt ggcaagagaa atctgcttga atcaagcgct atccagacgt       600
     tacaatgcta ttgccactag aagagaggtc tgtatcgagg aatggggtct caagcttgac       660
     aaggatggta aactaatatc atcaaaaaac tag                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page