(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE267

CAGLA1_12.PE267      Location/Qualifiers
FT   CDS_pept        complement(640964..642556)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196070"
FT                   /locus_tag="CAGL0M06149g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62590.1"
FT                   /db_xref="HOGENOM:HBG124077"
FT                   /db_xref="InterPro:IPR003169"
FT                   /db_xref="UniParc:UPI00003B70E7"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJI0"
FT                   /transl_table=1
FT                   /translation="MDFSSSQKYIQTQTLLDNINGLQNLHVQDREGSKNNLTYAKNAAS
FT                   DVDGSQPLLNTDMIFKANNKNHTRYIDNTGILPDFSAHSSGNLNDLHAELSSPFYNIPT
FT                   IQNTTDMFDSHSHVSKTPLSIHQDVGTPTPTNKNSKVMETYGFVNTFLSPPVWRYIDIQ
FT                   GNTQGPFSSSDMTGWYLQGYFQPTLQLFRDSTSHDNSNSTSQMCNQLITLMDILNHTQN
FT                   YQDPFNKFDEMLMTKTPVTEMVNPIPNHINNNAVTLAEECSNKDVNIESQIVESSIQKE
FT                   DVQAIASKHNAIENTTLEKPKLPSLMESHTNSINNLNNTTKESSTTISIGGSNLNKQKS
FT                   FTSSNQSQLRNDEKYNGENTTRNSSNKWSEIAKKNAPQNNPVAPVQKKTIAVQKTSLTT
FT                   AKSTEIDEKKTLLSATEPISIVNEDPQLSVDEFFFWCRKQIKLNDGHSLKDVLELILSL
FT                   PTDSESESIISETIYASSDTMDGRRFTKEFNQKRRECEKSNSGIQLTELVSSYITDEDD
FT                   WDFQVVNRKGKKN"
     atggattttt cttcatcaca aaaatatatc cagacacaaa cgctactgga taacatcaat        60
     gggttacaaa atttacatgt gcaggacaga gagggctcta aaaacaattt aacgtatgcg       120
     aagaatgctg catcggatgt agatggctca caaccgctgt tgaacacaga tatgatattt       180
     aaagcaaata acaaaaatca tacaagatac attgacaata ctggaatact cccagatttt       240
     agtgcgcatt ctagtggtaa tttaaatgat cttcatgcag aattaagctc tcccttttac       300
     aatattccaa caattcaaaa cactaccgat atgttcgatt cacactcaca tgtatcgaag       360
     acgccattgt ctatacatca agatgttggc acccccacac caactaacaa gaactctaaa       420
     gtaatggaaa catacgggtt tgttaacact tttctctcac caccagtctg gagatatatt       480
     gacattcaag gcaacacaca aggtcctttt tcaagcagtg acatgaccgg gtggtatctt       540
     caaggatatt ttcaaccaac gttgcaattg ttcagggatt ctacaagcca cgataactca       600
     aatagtacta gccagatgtg caaccagctc attacattaa tggacatttt gaaccataca       660
     caaaattacc aggacccgtt caataagttt gacgagatgc tcatgacgaa gacgcctgtg       720
     acagaaatgg tcaaccctat tccgaatcac attaacaaca atgccgtaac tttagcggag       780
     gaatgtagca ataaagacgt caacatagag tcccaaattg tcgagagttc aattcaaaag       840
     gaagatgtcc aggccatagc tagtaaacac aatgcaattg agaatacaac tctcgaaaaa       900
     ccaaagttgc cctcattaat ggaaagccat accaattcaa ttaataactt gaacaacact       960
     accaaggagt cttcgaccac tatatccatt ggtggtagta atttaaacaa gcagaaatcc      1020
     ttcacttcat caaaccaatc tcaactgaga aatgacgaaa aatacaatgg cgagaacaca      1080
     accagaaact cttccaacaa atggagtgaa attgctaaga aaaacgctcc tcaaaataac      1140
     ccagttgctc cagtgcaaaa gaaaacaata gctgttcaaa aaactagttt aactaccgcc      1200
     aaatccaccg aaatagatga gaaaaaaact ttattatcag caacggaacc gatatctatt      1260
     gttaatgagg acccacaact tagcgttgat gaattcttct tctggtgccg aaagcaaatt      1320
     aaactgaatg atggtcactc attaaaggat gtacttgaat taatactcag tcttccaacc      1380
     gactctgaat ctgaaagtat tatttcagag actatttatg ctagtagtga cacaatggac      1440
     ggtaggagat ttacaaaaga atttaatcag aagcgcagag agtgtgaaaa aagtaacagc      1500
     gggatccaac taactgaatt ggtgtctagc tacatcacag atgaagatga ctgggatttt      1560
     caggtggtga atagaaaagg caagaaaaat tga                                   1593
//

If you have problems or comments...

PBIL Back to PBIL home page