(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE268

CAGLA1_12.PE268      Location/Qualifiers
FT   CDS_pept        complement(643102..643542)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000175329" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438968"
FT                   /locus_tag="CAGL0M06171g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62591.1"
FT                   /db_xref="HOGENOM:HBG059999"
FT                   /db_xref="HOGENOM:HBG325020"
FT                   /db_xref="InterPro:IPR008012"
FT                   /db_xref="UniParc:UPI00003B70E8"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJH9"
FT                   /transl_table=1
FT                   /translation="MSIVPKGHQDRVSTSQGVTSNAASLPDTLRMQEGGAVPLSSQLND
FT                   RHPLMHRVQNWEETQHRRQLEQYRNIFGLAEPMRRMMEIGIVDATDFNPVSQGQSSIHR
FT                   DILMNKETSVDWEDIYPENNGLLSGNMVGDDVHTQIERKVGI"
     atgagtattg ttccaaaggg tcatcaggat agagtgtcga cgagccaagg ggtgacgtct        60
     aatgcggcca gtttgccgga cacgctgaga atgcaagaag gtggtgctgt gccattgtca       120
     tcgcaattga acgatagaca tcctctgatg caccgtgtac agaattggga agagacacag       180
     cataggagac agctggagca atatagaaac atatttggtc ttgccgagcc tatgagacgt       240
     atgatggaga tcgggatagt ggatgctacc gacttcaacc ctgtctccca gggccagagc       300
     tcaattcacc gcgatatact tatgaacaaa gagaccagtg tggactggga ggacatttac       360
     cctgaaaaca acggactgct atcaggtaac atggtcggtg atgacgtgca tacacagata       420
     gaacgcaagg ttggtatata a                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page