(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE274

CAGLA1_12.PE274      Location/Qualifiers
FT   CDS_pept        join(complement(655501..655506),complement(654006..654710))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000190952" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438971"
FT                   /gene_name="RPS6B"
FT                   /locus_tag="CAGL0M06303g"
FT                   /product="40S ribosomal protein S6 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAG62597.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG022722"
FT                   /db_xref="HOGENOM:HBG316337"
FT                   /db_xref="InterPro:IPR001377"
FT                   /db_xref="InterPro:IPR014401"
FT                   /db_xref="InterPro:IPR018282"
FT                   /db_xref="UniParc:UPI00003B66F9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJH3"
FT                   /transl_table=1
FT                   /translation="MKLNIAYPVNGTQKTVEVDDEHRVRVFYDKRIGQEIEGEAVGDEF
FT                   KGYTFKITGGNDKQGFPMKQGVLLPTRVKLLLAKGHSCYRPRRSGERKRKSVRGAIVGP
FT                   DLAVLSLVIVKKGEQELEGVTDATVPKRLGPKRANHIRKFFGLTKEDDVRDFVIRREVT
FT                   KGEKTYTKAPKIQRLVTPQRLQRKRYQRNLKVRNAQAQREAAAEYAQLLAKRLAERKAE
FT                   KAETRKRRASSLKA"
     atgaagttga acattgctta cccagttaat ggtactcaaa agaccgtcga agtcgatgac        60
     gaacaccgtg tccgtgtctt ctacgacaag agaatcggtc aagaaatcga aggtgaagct       120
     gtcggtgatg aattcaaggg ttacaccttc aagattaccg gtggtaacga caagcaaggt       180
     ttcccaatga agcaaggtgt cttgttgcca accagagtta agcttttgtt ggctaagggt       240
     cactcctgtt acagaccaag acgttctggt gaaagaaaga gaaagtctgt cagaggtgcc       300
     attgttggtc cagatttggc tgtcttgtct ttggtcatcg tcaagaaggg tgaacaagaa       360
     ctagaaggtg tcactgatgc tactgttcca aagagattgg gtccaaagag agctaaccac       420
     atcagaaagt tcttcggttt gactaaggaa gatgatgtcc gtgacttcgt tatcagaaga       480
     gaagttacca agggtgaaaa gacctacact aaggctccaa agatccaaag attggttact       540
     ccacaaagat tgcaaagaaa gagataccaa agaaacttga aggtcagaaa cgctcaagct       600
     caaagagaag ctgctgctga atacgctcaa ttgttggcta agagattggc tgagagaaag       660
     gctgaaaagg ctgaaaccag aaagagaaga gcttcttctt tgaaggctta a                711
//

If you have problems or comments...

PBIL Back to PBIL home page