(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE275

CAGLA1_12.PE275      Location/Qualifiers
FT   CDS_pept        complement(657290..659269)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438972"
FT                   /locus_tag="CAGL0M06325g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="sequence-specific DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62598.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="HOGENOM:HBG124078"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="UniParc:UPI00003B70EE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJH2"
FT                   /transl_table=1
FT                   /translation="MGRRKIEIEPITDSKTRGITFLKRKAGIFKKAHELSVLCNVDVAV
FT                   VVLGANGTFYEFSSVEMDELLRYYTDQNGMGLLHIKTEPSAYGDGYKKTPTVKYQGTRH
FT                   LKRGRRLAKTKSVDLNQIRRASVGAPDNSTVNASSETNKKRQIKDEEGNGVDDDLNNAA
FT                   VKLRKLTHARHHSTGNSLLPQMDSNVKLGSLAFDSHERDSDLKLTRTRSFPFVGDISTE
FT                   KVTQTNEQLEKAAPKFIVNSPPGSLNRESSHSNYMRPATNFNMGRSSTNGSTSKKLKPI
FT                   LKLNIPIDNTNAANGVRNYSNQHASNSAENDLPKHIIRTPFQGSNFRVSPNVKHEGSYF
FT                   KNENIIDSENGNSKLTFSYGNDKNIKNQFRPPFFGSMKGNNSAGGSNNIAGSPTNQYLI
FT                   TPLQQMNPNRVPLYKGAATTNSGSSLSTSLNMNGEVSTPNTANGNTASQRQLFGAFYSS
FT                   GADSGKLHKNDKPNMFSNNQGDENDDVEGQDDVGQETRSENTSMAMNRNIMPATTPIGP
FT                   ESSSQPLKMGPDFLGSTNSPNTSTMLFPDWNLSATGTNFSGQNFLNSAGPKSGNIFGFP
FT                   PLANYPFVGTGYGNSSNNSNNNNNNNGNNTNSNSNNQSINGGNPSKISGSELSPYLPHL
FT                   HTPYPGKIFQFNNNDTNESYQASK"
     atggggcgca ggaagataga gatcgagccg attacggact cgaagactag aggcataacc        60
     ttcttgaagc gtaaagcggg tatatttaag aaggcacatg agctgagcgt gctgtgcaat       120
     gtggatgtgg cggtggtggt gctgggtgcc aacgggacgt tctacgagtt cagcagtgtc       180
     gagatggacg agctcctgcg gtactacacg gatcagaacg ggatgggcct gcttcatata       240
     aagaccgagc cttctgctta cggtgacggg tacaagaaga cgcctacggt gaagtaccaa       300
     ggcacaagac acctgaaacg tggtcgtagg ctggccaaga ccaagagtgt ggacttgaac       360
     cagattagaa gagcttcagt gggtgcccca gacaactcta ctgtgaatgc cagctcagaa       420
     acgaacaaga aacgccagat caaggacgaa gaaggaaacg gtgtggatga cgacctaaat       480
     aacgccgcgg tcaagttgag aaagctgact cacgcaaggc atcacagtac cggaaactca       540
     ttgctaccac aaatggatag caatgtgaaa ctcggtagtc tggcttttga ctctcacgaa       600
     cgtgattcag acttgaaact gacaagaacc agaagcttcc catttgtagg tgacatatca       660
     accgaaaagg ttacacagac caatgagcaa ctggaaaaag cagctccaaa attcatagtg       720
     aattcacctc ccggctcttt aaatagagaa tcatcacatt caaactatat gagaccagca       780
     actaatttta acatgggtag atcatcaacc aatgggtcca cttccaaaaa actaaaacca       840
     atactaaaac ttaatattcc catagataac actaatgcag caaacggtgt tagaaattac       900
     tcaaaccaac atgcctccaa cagcgccgag aatgacctac ctaaacatat cataaggaca       960
     cccttccagg gttctaactt ccgtgtttca cctaacgtaa agcatgaagg tagctatttc      1020
     aagaatgaaa acattattga cagtgaaaac ggtaattcaa aactcacatt ttcatatggc      1080
     aacgataaga acattaagaa tcaatttagg cctccgttct tcggctcaat gaaaggcaat      1140
     aacagtgccg gaggtagcaa taacatcgct ggatcaccaa caaaccagta cctgataaca      1200
     ccattgcaac aaatgaatcc aaatagagtg cccttatata aaggtgcagc aacaactaat      1260
     agtggctctt ctttatcaac ctcactaaac atgaatggag aagttagcac acctaatact      1320
     gcaaatggaa atactgcttc acaaagacag ttgtttggag cattctactc ctcaggggcc      1380
     gactctggaa agcttcataa gaatgacaag cctaatatgt ttagtaataa ccaaggagat      1440
     gaaaatgatg atgttgaggg tcaagatgat gtaggtcaag aaaccagaag tgagaataca      1500
     agtatggcaa tgaaccgtaa cattatgcct gccacaaccc ctataggtcc tgaatcaagt      1560
     tcgcagccac tgaaaatggg accggatttc ttgggtagta ctaactctcc aaatacttct      1620
     acaatgctat ttccagattg gaatttgtct gcgacaggta cgaattttag cggacagaat      1680
     ttcttgaaca gtgccggccc aaaatctggt aatatattcg gattcccacc tttggctaat      1740
     tatccttttg tgggtacagg atacggaaac agtagcaata atagtaacaa caacaacaac      1800
     aacaacggta acaacactaa cagcaacagc aacaaccaaa gtattaatgg aggaaaccct      1860
     tcaaaaattt ctggttcaga attaagtccg tatcttccac acctacatac cccttatcca      1920
     ggtaaaattt tccagttcaa taacaatgat acaaatgaaa gttaccaggc ttcaaaatga      1980
//

If you have problems or comments...

PBIL Back to PBIL home page