(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE276

CAGLA1_12.PE276      Location/Qualifiers
FT   CDS_pept        660288..661232
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000192011" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196071"
FT                   /locus_tag="CAGL0M06347g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="hydrolase activity, acting on carbon-nitrogen
FT                   (but not peptide) bonds, in linear amides"
FT                   /biological_process="ceramide metabolic process "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62599.1"
FT                   /db_xref="GO:0006672"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0016811"
FT                   /db_xref="HOGENOM:HBG196338"
FT                   /db_xref="HOGENOM:HBG735397"
FT                   /db_xref="InterPro:IPR008901"
FT                   /db_xref="UniParc:UPI00003B70EF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJH1"
FT                   /transl_table=1
FT                   /translation="MIRWEYPQAQDGYWGEITSTIDWCEENYVVSHYVAEWSNTFTNSI
FT                   FISTALYTIYCTRRNKLELRFLLIGLAYCLVGVGSWLFHMTLKYHFQLLDELPMIYAMC
FT                   VPCWSLITELIATFTGPTKNKHSNGKTNTLSSVKQVVIASLILLTASTVTVVYLIVKNA
FT                   TIHQAFFGCLIGVVAFSSAYMVMTFVKDPQHKKNLHNSMMMGAIFFMSGYAVWLMDIHL
FT                   CKLWRFIRREYLLLPLGLLLELHGWWHVLTGLGIYYYIVCLQYLRLITTDRLQHYKLIW
FT                   RWGLLPELVPADYNIGTPYSLTFRGPREKAKPE"
     atgattcgtt gggaatatcc gcaagcgcag gatggttact ggggggagat aacctccact        60
     atagactggt gcgaggagaa ctacgtggtc tcgcactatg tagcagaatg gtctaacact       120
     ttcacaaact ccattttcat cagcaccgcc ctgtacacaa tctactgcac gcgacgtaac       180
     aagctcgagt tgaggttctt gctcataggg ctcgcgtact gcctcgtggg tgtcgggtcc       240
     tggctgtttc acatgacgtt gaaataccac ttccagttgc tcgacgagtt gcccatgata       300
     tacgccatgt gtgtgccgtg ctggtccctg atcacagaac tgatcgcgac cttcacgggc       360
     cccaccaaga acaagcacag caatggcaaa accaatactt tgtccagtgt gaagcaggtg       420
     gtcatcgcat ccttgatcct gttgactgca tcaacggtca ctgtggtgta cctgatagtc       480
     aagaacgcca ccattcacca ggctttcttc gggtgcctga tcggcgtggt ggcattctcc       540
     tcggcctaca tggtaatgac tttcgtcaag gacccccaac acaagaaaaa cttgcacaac       600
     agcatgatga tgggcgccat attcttcatg tcgggttacg cagtatggct aatggatatc       660
     cacttgtgta agctgtggag gttcattagg cgcgagtacc tgctgctgcc cctgggcttg       720
     ctcctggagc tgcacggatg gtggcacgtc ctcacgggac tcggcatcta ctactacatc       780
     gtatgcctgc aatacctaag actgatcacc actgatcgct tacagcatta caaactcatc       840
     tggagatggg gccttctacc ggaattggtc cccgccgact ataacatcgg caccccatac       900
     tctctcacat tcagaggccc acgtgagaaa gctaagccgg agtga                       945
//

If you have problems or comments...

PBIL Back to PBIL home page