(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE279

CAGLA1_12.PE279      Location/Qualifiers
FT   CDS_pept        664851..667517
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000095264" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438973"
FT                   /gene_name="BRO1"
FT                   /locus_tag="CAGL0M06413g"
FT                   /product="Vacuolar protein-sorting protein BRO1 "
FT                   /biological_process="protein transport"
FT                   /cellular_component="endosome"
FT                   /protein_id="CAG62602.1"
FT                   /db_xref="GO:0005768"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG059997"
FT                   /db_xref="HOGENOM:HBG203904"
FT                   /db_xref="InterPro:IPR004328"
FT                   /db_xref="UniParc:UPI00003B70F2"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJG8"
FT                   /transl_table=1
FT                   /translation="MKPSVIGLKCKDTDKVDWKRGLSSYLKRIYGSRQWKEFYDEQLCV
FT                   EMDHVRNNANGELGAVTLVEQNYKYYAYLEQLYLRLGNNIGQFKLEFTWYDAEYGLVSS
FT                   PTKHTQKTLVFEKSCTLYNLGVALTEVANEKINEDFKTAMVHMAKAMECFRYLSENFFN
FT                   SPSADLQTENTKFLSDLSHAEAQEMFLINAINNGTSEKQASLISKLAYSGSNLYENCWE
FT                   FLRTEEGGLTPYGEARWNSIVSGKHHFFRSLAAYYNALALEQNNKYGEAIAFLKLATQC
FT                   LSSSLPYKYALNDNFDFDGFGETIKDKTKQLIKDNDYIFHDSIPQSVSLSSIKALDAIK
FT                   APKWEEQLKPFMEAIAHKCEKLYRGIVPMEVFEKESIYSEKKASMLRQCINDSETADME
FT                   YSSFIEFTHLPNLLSDLKRRYKSQNFSGTTDPQGDMMRDQIQSWIKSISQSKYKDPDEQ
FT                   LKLISSKKQEILTLLAGLPSEQKENVVKLKMALVEAAASDEKLFSLVQPYAAQLRLLKQ
FT                   PDELWKIFNMFSIDESNKQSLLDIDDSKNQEILAKISDIEQMAEDLRLLKEERGRTLKE
FT                   LKSQTNDDDITNTLLVNSKAESEELEVIFKKELDKFKPLTTRIEATIFKQESVVNEVKN
FT                   ELDNVFSLSGLENKTSEEEEKQKKRKEFFMQIEEAATKFLIFNNDLPKGLEFYDSLLKM
FT                   SKDLAVSVKVQNNASGSDNNSNNGYVSGNVIPPSLPPQPRNVGSSIDSQFQSMNLGSVP
FT                   TPQRFPQPPAPNSRPIVSMENYTSQFSVPPAHGDLPPAYNQVPLVPTRNYDQPHGSGNY
FT                   PGNVSSQHPVSSSPIPGAYDQVPMVPPKQPPAEGRSQISRQEQMEREERELQRDPTAFY
FT                   KKSSVFDESLYSRYSGK"
     atgaagccat cagtgattgg tttgaagtgt aaggataccg ataaggtaga ttggaagcgg        60
     ggattgtcta gttatttgaa gaggatttat ggttcgagac agtggaagga gttctatgat       120
     gagcaactat gtgtggagat ggaccatgtg cgcaacaatg ctaatggcga gttaggggca       180
     gtcacattgg tggaacagaa ctacaagtat tatgcttact tggaacagtt atatttgaga       240
     ttgggaaaca atattggtca gtttaagctg gagtttacgt ggtatgacgc tgagtatggt       300
     cttgtttcaa gtcctacaaa gcatacccaa aaaacattgg tgttcgaaaa atcatgtacg       360
     ttgtacaatt tgggtgtagc gttaacagaa gtggcaaatg agaaaattaa tgaggatttt       420
     aaaaccgcca tggtacatat ggcaaaggcc atggaatgtt ttaggtatct ctctgaaaat       480
     ttctttaatt ccccctcagc agatcttcaa actgaaaaca ccaaattcct ttcagatttg       540
     tcacatgctg aagctcagga gatgttcttg atcaatgcga tcaataacgg aacatctgag       600
     aaacaagctt ctctaattag taaacttgca tactccgggt caaatctata tgagaattgt       660
     tgggagtttt taagaacaga ggaaggtggg ttaacacctt atggtgaggc aagatggaac       720
     agtatcgtct ccggtaaaca ccattttttt cgctcgttgg ctgcctatta taatgcatta       780
     gcactagagc aaaataacaa atacggtgaa gcaatagcgt ttttgaaatt ggctactcaa       840
     tgtctgtctt cctcacttcc atataaatat gctctgaatg ataattttga ttttgatggc       900
     tttggtgaaa caataaagga taaaaccaag caattaataa aggataacga ttatattttc       960
     cacgatagta taccccaatc agtatcgttg tcttcaatta aagcattaga tgccataaaa      1020
     gcacctaaat gggaagaaca actcaaaccg ttcatggaag ctatcgcaca caaatgtgaa      1080
     aagttatata gaggaattgt gccaatggag gtatttgaaa aggagagtat atactctgag      1140
     aaaaaggctt ctatgctcag gcagtgtatc aatgattcag aaacggcaga catggagtat      1200
     tcttcattca ttgagttcac tcatttgcca aatctactta gcgacctcaa gagaaggtat      1260
     aagagtcaga atttttcagg taccacagat cctcaaggtg acatgatgag agatcaaata      1320
     caatcttgga ttaaaagcat tagtcaaagt aagtataaag atcctgatga acaattgaaa      1380
     ttaataagtt caaaaaaaca agaaatttta acgctactag caggtttgcc ctcagaacaa      1440
     aaggaaaatg tggtcaaact caaaatggca cttgttgaag ctgctgcttc agatgaaaaa      1500
     ttattttcac tagttcagcc gtatgcagct caattaagac ttctgaaaca acctgatgaa      1560
     ctatggaaaa tattcaatat gttttcaatt gatgaatcta ataaacagag tctcttagat      1620
     attgatgata gcaagaatca agaaattcta gcaaaaatat ctgatattga gcaaatggca      1680
     gaagatttga gacttctaaa ggaagaaaga gggcgtacac tcaaggaact aaagagtcaa      1740
     actaatgatg atgatattac caatacttta ctggttaact caaaggcgga aagtgaagag      1800
     ctagaagtca tctttaagaa ggagctagac aaatttaaac ctttgactac gaggattgag      1860
     gcaaccatat ttaaacagga atctgttgtt aatgaagtca agaatgagct tgataatgtt      1920
     ttcagtcttt ctggcttaga aaataagaca tcagaagagg aagagaaaca gaagaagagg      1980
     aaggaattct tcatgcaaat tgaagaggcg gctacaaagt ttttaatttt taataatgat      2040
     ttgccaaagg gtctcgagtt ttatgattcg cttttgaaaa tgagtaaaga cctagcagta      2100
     tctgtaaaag tccaaaataa tgctagtgga agtgacaata atagcaacaa tgggtatgta      2160
     agtgggaatg ttattccacc atcactacca ccgcagccaa gaaacgtagg ttccagcatt      2220
     gattcgcaat ttcagtccat gaatctagga agtgtaccta cgccacaacg ttttcctcaa      2280
     ccgccagctc ctaattctcg accaatcgtt tctatggaaa attatacctc tcagttctct      2340
     gtgccacctg cacatggtga tttaccgcct gcttacaatc aggttccgct ggttccaaca      2400
     agaaactatg accagcccca tggttcaggg aattatccag gaaatgtctc aagccaacat      2460
     ccagtttcat cttctccaat acctggagct tatgatcaag tgccaatggt ccctccaaag      2520
     caaccgcctg cagaaggtag aagtcagata tccagacaag aacaaatgga aagagaagaa      2580
     cgtgaattac aaagagatcc tacagcattt tataagaaat cttcggtctt tgatgaaagt      2640
     ttgtattcaa gatatagtgg taaataa                                          2667
//

If you have problems or comments...

PBIL Back to PBIL home page