(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE283

CAGLA1_12.PE283      Location/Qualifiers
FT   CDS_pept        join(672743..672749,673624..674201)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000194525" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438977"
FT                   /locus_tag="CAGL0M06501g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="rRNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="CAG62606.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="GO:0019843"
FT                   /db_xref="HOGENOM:HBG053230"
FT                   /db_xref="HOGENOM:HBG588353"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005710"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="UniParc:UPI00003B70F6"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJG4"
FT                   /transl_table=1
FT                   /translation="MPRAPRTYSKTYSTPKRPYESSRLDAELKLAGEFGLKNKREIYRI
FT                   SFQLSKIRRAARDLLTRDEKDPKRLFEGNALIRRLVRIGVLSEDKKKLDYVLALKIEDF
FT                   LERRLQTQVYKLGLAKSVHHARVLITQRHIAVGKQIVNIPSFMVRLDSEKHIDFAPTSP
FT                   FGGARPGRVARKNSGKASEGGDDAAEEADEE"
     atgccaagag ccccaagaac ttactctaag acctactcta ccccaaagag accttacgaa        60
     tcttctcgtt tggacgctga attgaagctt gctggtgaat tcggtttgaa gaacaagaga       120
     gaaatttaca gaatttcttt ccaattgtcc aagatcagaa gagctgctag agatcttttg       180
     accagagacg aaaaggaccc aaagagattg ttcgaaggta atgctttgat cagaagattg       240
     gtgagaatcg gtgtcttgtc cgaagacaag aagaagttgg attatgtctt ggctttgaag       300
     attgaagatt tcttggaaag aagattgcaa actcaagttt acaagctagg tttggccaag       360
     tctgttcacc acgctagagt cttgatcact caaagacaca ttgctgttgg taagcaaatc       420
     gtcaacatcc catctttcat ggtcagattg gactctgaga agcacattga cttcgctcca       480
     acttctccat tcggtggtgc cagaccaggt agagttgcta gaaagaactc cggtaaggcc       540
     tccgaaggtg gtgacgatgc cgctgaagaa gctgacgaag agtaa                       585
//

If you have problems or comments...

PBIL Back to PBIL home page