(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE285

CAGLA1_12.PE285      Location/Qualifiers
FT   CDS_pept        677238..679001
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000154429" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196072"
FT                   /gene_name="SSH4"
FT                   /locus_tag="CAGL0M06545g"
FT                   /product="Protein SSH4"
FT                   /biological_process="protein transport"
FT                   /cellular_component="endosome membrane"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="vacuolar membrane"
FT                   /protein_id="CAG62608.1"
FT                   /db_xref="GO:0005774"
FT                   /db_xref="GO:0010008"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG202416"
FT                   /db_xref="HOGENOM:HBG252595"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="UniParc:UPI00003B70F8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJG2"
FT                   /transl_table=1
FT                   /translation="MPLIPDSIQSIGVFHVDDPFNPMPDPGDADPETVAFAFFIGIAVV
FT                   FSLLLITLVCTAAYLVCTSSYEGEYDEELANNGDGSRRGILNFRPLFGKKNSNGLLLDS
FT                   NFTNPGEFDDNEEFIEREREALIKMSPFEVDSYMRAKEFQIVSPPAVQEFGTYLDSKDL
FT                   QMIKDRGIQSYYFIPSINDNVDKSGHFLPSFLVQDKLEVEFTRWNKSSSAVLNYPLPYN
FT                   KKDAVYFEVKVYNHKPNSNSIFSIGLVTVPYPYFRIPGMCKFSIAYESTGKLRINDPFF
FT                   PSTLLPKLVEGDVVGFGYRFKTGTIFITHNGKKLMDVTQNVSVELFIALGAMNASYTRT
FT                   YTKDGLLEDPDNIELRNALAEGRELKLSKDIQNPHNPMDETKWDIIDSDEIELHVNLGQ
FT                   TGFVFIEANVKKYGFGSVFGEIGIPPAYNPNDIQKDKLIQKGEELPPQYPEDTENFGLF
FT                   GNLKIKSHIKNPLKEVSSNPSAPELIQKKLKTPIVKTPKVGIYEFTTPIDRKRETNMQP
FT                   SINPPVYEINDTRQSSPEITNETISNEETVSSSSKAEPALQHGQSNKTPNKRQNKKTKQ
FT                   RKNKKKGKKNK"
     atgccgttaa tacctgactc tatacagtcg ataggggttt ttcatgtgga tgaccctttc        60
     aaccctatgc cagatccagg tgatgctgat cctgagactg tcgcttttgc attttttata       120
     ggaattgcgg ttgtattttc actgttattg attacattag tatgtactgc tgcttatcta       180
     gtttgtacca gctcttacga aggtgaatac gatgaagaat tagctaataa tggagatggt       240
     agtagacgtg gtatcttgaa tttccgacca ttgtttggta agaagaactc aaatggtttg       300
     ctattagatt ctaattttac taatccaggc gaatttgatg acaacgagga gtttatcgag       360
     cgggaacgtg aagcgctaat aaagatgtca ccatttgaag tagattctta tatgagagcc       420
     aaagaatttc agatagtgtc gccacctgct gtccaagagt ttggtacgta ccttgactca       480
     aaagatttgc agatgattaa agatagaggc atacagagct actatttcat tcctagtatt       540
     aatgacaatg tcgataaaag tggccatttt ttgccaagct ttttagtaca agataaatta       600
     gaggtagaat ttaccagatg gaataaaagt tcttcagcag tgctcaacta tccattacca       660
     tacaacaaaa aggatgctgt ttattttgaa gtaaaagttt acaatcataa acccaactcc       720
     aattctatat tcagtattgg tttggtgact gttccttacc catatttcag gattcccgga       780
     atgtgtaaat tttctattgc ttatgagtca actggtaagc taaggattaa tgacccattc       840
     tttcctagca ccttgctacc taaattagtt gaaggagatg tagttggttt tgggtatagg       900
     ttcaagacag gtactatatt cattacgcac aatggtaaga aattgatgga tgttacacaa       960
     aatgtcagtg ttgagctttt catagcacta ggcgcaatga atgcttcata tacccgaacg      1020
     tacacaaaag atggcttact cgaggatcca gacaacattg aactaagaaa tgctctagca      1080
     gaagggaggg aactcaaact cagcaaagat attcaaaatc ctcataaccc aatggatgag      1140
     acaaaatggg acataattga ctcagatgag atcgagcttc atgtaaattt aggacaaaca      1200
     ggatttgttt tcatagaagc aaatgtcaag aagtatggtt ttgggagtgt tttcggggaa      1260
     ataggaatac ctccagctta taatcccaat gatatacaaa aagacaaact gatacaaaaa      1320
     ggggaagaac tacctcccca atatcctgag gatacagaga attttgggtt atttggtaat      1380
     ctaaaaatta agagtcacat aaaaaaccca ttgaaagaag ttagtagtaa tccttctgct      1440
     ccagaattaa tccaaaaaaa gctcaagaca cctatcgtga agactccaaa agtcggaata      1500
     tatgaattta ccaccccaat tgacagaaag agggaaacga atatgcagcc atcaataaac      1560
     cctcctgttt atgaaattaa cgatactaga caatcttctc cggaaattac gaatgaaacg      1620
     atatcaaatg aagaaacagt atcaagctcc tctaaggcag agccggcttt gcaacatggg      1680
     caatcaaata aaacaccaaa taaacggcaa aataagaaga cgaagcaaag aaaaaacaaa      1740
     aagaaaggaa agaaaaataa ataa                                             1764
//

If you have problems or comments...

PBIL Back to PBIL home page