(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE287

CAGLA1_12.PE287      Location/Qualifiers
FT   CDS_pept        680678..681355
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000001030" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438978"
FT                   /locus_tag="CAGL0M06589g"
FT                   /product="Similar to uniprot|Q12084 Saccharomyces
FT                   cerevisiae YDR020c"
FT                   /function="ATP binding"
FT                   /function="kinase activity"
FT                   /function="phosphotransferase activity, alcohol group as
FT                   acceptor"
FT                   /protein_id="CAG62610.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="GO:0016773"
FT                   /db_xref="HOGENOM:HBG203124"
FT                   /db_xref="HOGENOM:HBG465606"
FT                   /db_xref="InterPro:IPR000764"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="UniParc:UPI00003B70FA"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJG0"
FT                   /transl_table=1
FT                   /translation="MDKRILLLIGGGHDTGVKSMSNELKTKFDSLFPESNIKVIDIDYE
FT                   QEYMISPARIKRSYSNEDYDFDVLYNTLTHQSEHKAEGEVDIIIVCGCYALYNQKINEL
FT                   ANLRVFVESDGDVRLINKIRSENIDNSEQLATTLQEYLQNLRPEMENYIEPTRVHAHLI
FT                   IPYANKDSGVAIIVDGMVKIVNEVSNSRSPDRQNSKEIARNQLYDFLGESMDNERSRYY
FT                   DLA"
     atggataagc gtatacttct actaattggt ggaggacatg atactggtgt caagtcgatg        60
     agcaatgagc tgaagacgaa atttgacagc ctgtttcctg agtcgaatat caaagttatt       120
     gatatagact atgaacagga atatatgata tcaccagcac ggattaagag aagctattct       180
     aacgaagatt acgattttga tgttctctac aatacattaa cacatcaatc ggaacataaa       240
     gcagaagggg aggttgatat aataattgta tgtggttgtt atgcacttta caatcaaaaa       300
     atcaatgaat tggcaaattt gagagtattt gttgaaagtg atggcgatgt taggttgatt       360
     aataaaatta ggtcagaaaa tattgacaac tcagaacaac tagcaaccac tcttcaggag       420
     tatctacaga acctacgacc tgagatggag aattatatcg aaccaactag agtgcatgct       480
     catttaataa tcccatacgc aaataaggac tctggtgtgg ctattattgt cgatggtatg       540
     gtcaaaattg ttaatgaggt ctcaaattct agatcaccag acagacaaaa ttcgaaagaa       600
     atagctagaa atcaattata cgacttcttg ggtgaaagca tggataatga acgcagcaga       660
     tattacgatt tggcttaa                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page