(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE292

CAGLA1_12.PE292      Location/Qualifiers
FT   CDS_pept        complement(686466..687554)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141851" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438981"
FT                   /locus_tag="CAGL0M06699g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62615.1"
FT                   /db_xref="HOGENOM:HBG058585"
FT                   /db_xref="HOGENOM:HBG203057"
FT                   /db_xref="InterPro:IPR013907"
FT                   /db_xref="UniParc:UPI00003B70FD"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJF5"
FT                   /transl_table=1
FT                   /translation="MEEMEVQKRLTSKDVPRKDKRRVNLENRVGKIQQSFILERDSYYR
FT                   DRLTSLQTDLTSLHQGNNELFMRKLRDLEEARDLELVRLRLYEEYRVYRSGIEFQEEIE
FT                   KTKEDHERLVKICKERLYQNIEMKTKKLQEERLLMDVANIHTYSMDYDRPHYQKNTRSH
FT                   TASGWESSSNDFGRDTANESATDTGLSGFGNERRSLRRRVVLGREGSGLEGGNGGNATS
FT                   GYTSGGINGDGYNYGKSYNTEDSDGGRYGANPYASPSGRGSQRQNNSGGYRTDMNSDTE
FT                   FLQSIGDSSELYNLLFGDKNVGGKDGNKSSSDKKKPRGTQRYSMKTAPPLQSLKTEEVS
FT                   EDIALIRELTGQPPAPFKVDKQ"
     atggaagaga tggaagtaca gaaaaggctt acttccaagg atgttccaag gaaggacaag        60
     cgtcgagtta atcttgagaa ccgggttggt aaaattcagc aaagttttat attggagaga       120
     gattcttact acagagacag gttgacctcc ttgcaaaccg atctgacttc tttgcatcaa       180
     ggtaataatg agttatttat gcggaaactg agggacttgg aagaggcaag agatcttgaa       240
     cttgtgagac tgcgacttta tgaagagtat agggtataca gatcgggaat agagtttcaa       300
     gaggagattg agaaaactaa agaagatcat gagaggttgg tcaaaatatg taaagagaga       360
     ctctatcaaa acatcgagat gaaaactaaa aaactacaag aagaaaggct tcttatggat       420
     gttgcaaata ttcatactta ttctatggac tacgacaggc cgcactatca aaaaaacaca       480
     aggagtcaca ccgcaagcgg gtgggaatcc tcttccaatg attttgggag agatactgca       540
     aatgagagtg ccactgatac tggtttatcg gggttcggca atgagaggag gtcattgaga       600
     agaagagttg ttcttggaag agaaggttcc ggtctggaag gtggaaacgg tggaaatgcc       660
     actagtggat atactagtgg tggtattaac ggcgatggtt ataactatgg taaaagttat       720
     aatacagagg actcagatgg tggtcgatat ggtgccaatc cttacgctag tccttctggt       780
     aggggttccc aaagacagaa taatagtggg gggtacagaa ccgatatgaa ttcagatact       840
     gaatttttac aaagtattgg cgatagttca gagttataca acctgttatt tggggacaag       900
     aacgttggag gtaaagatgg taacaagtca agctcggata agaagaagcc aaggggaacg       960
     cagcgatatt ctatgaaaac tgcaccaccg cttcaatcat tgaaaacaga ggaggtctcc      1020
     gaagacattg ctctaataag agagttgacg ggccaaccac ctgcaccctt taaggttgat      1080
     aagcaataa                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page