(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE294

CAGLA1_12.PE294      Location/Qualifiers
FT   CDS_pept        690036..690878
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000188365" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044872"
FT                   /locus_tag="CAGL0M06765g"
FT                   /product="Similar to uniprot|P53965 Saccharomyces
FT                   cerevisiae YNL032w SIW14"
FT                   /function="protein tyrosine phosphatase activity "
FT                   /protein_id="CAG62617.1"
FT                   /db_xref="GO:0004725"
FT                   /db_xref="HOGENOM:HBG202707"
FT                   /db_xref="HOGENOM:HBG253090"
FT                   /db_xref="InterPro:IPR004861"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020428"
FT                   /db_xref="UniParc:UPI00003B70FF"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJF3"
FT                   /transl_table=1
FT                   /translation="MSPGSGEESPLRDIVRSTSSLKIDDLIKNESDIIRILNQQEDLLM
FT                   DNGRVRNVHHLVDEDNLLREEFDKVLKQFHGNEDNELKIKGNEEDIDDLFDEEEHKKSS
FT                   TGLLLSCDSEVTPPENFSHVVGEIYRSSFPRTENFAFLQKRLKLKSILVLIPEEYPQEN
FT                   LDFMEKANIKLFQVGMSGNKEPFVNIPSDLLTKALEVVLNPENQPILIHCNRGKHRTGC
FT                   LIGCIRKLQSWSLTMIFDEYRRFAFPKARALDQQFIEMYDDDKIKSIATQNKWLPLQW"
     atgtctccag gtagtggtga agagagtccg ttgcgagaca ttgtgaggtc gaccagcagt        60
     ttgaagatag atgatttgat caagaatgag tcagatataa tacggatttt aaaccagcaa       120
     gaagacttgc ttatggacaa tggtcgggta cgaaatgtgc accatttagt tgatgaagac       180
     aacctattac gagaagaatt cgacaaagtg ctgaagcaat ttcatggtaa tgaagataac       240
     gagctcaaga ttaaaggtaa cgaggaagat attgacgatt tattcgatga agaagagcat       300
     aaaaaatcat caactgggct tctactgagc tgtgatagcg aggtaacgcc accagagaac       360
     ttcagtcatg ttgttggcga aatatataga agtagcttcc ctagaaccga aaactttgcc       420
     tttttgcaaa aacgtctaaa actcaaatct attttggttc ttataccgga agagtatcct       480
     caggagaatt tagattttat ggaaaaggct aacatcaagt tattccaggt cggcatgagc       540
     ggtaataaag agcccttcgt caatatccca tccgatctac taacgaaagc attagaagta       600
     gtgcttaatc cagaaaacca accaattctt atacactgta atcgtggaaa acatagaact       660
     ggatgtctaa tcggatgcat aaggaagtta caaagttggt ccttaacaat gattttcgat       720
     gaatacagaa gatttgcttt tcccaaagca agagccttag atcagcaatt tatcgagatg       780
     tatgatgacg acaaaatcaa aagtatagca acacaaaaca aatggctccc gttacaatgg       840
     taa                                                                     843
//

If you have problems or comments...

PBIL Back to PBIL home page