(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE295

CAGLA1_12.PE295      Location/Qualifiers
FT   CDS_pept        complement(691398..692996)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000160667" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196074"
FT                   /locus_tag="CAGL0M06787g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="glycolipid 2-alpha-mannosyltransferase activity "
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62618.1"
FT                   /db_xref="GO:0004377"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG192431"
FT                   /db_xref="HOGENOM:HBG396033"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="UniParc:UPI00003B7100"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJF2"
FT                   /transl_table=1
FT                   /translation="MRVKVKRWVNDAVEEVLDWLLSTIAIYMYITAIICGTFLYFTYPS
FT                   RTDIRFYSEQDLGTERDAPFYYGCVNTEGYLQAPEYKKMNAAFVMLTRNNELKDVLSSM
FT                   NSIEAHFNQWFKYPYVFLNDEPFSEEFKKSIREATDADIEFGTLDESQWEFPEEVRNTF
FT                   EYQNAITDQGDRGILYGNMESYHKMCRFYSGIFYKHPLMQKYEWYWRLEPDVEFFCDLT
FT                   YDPFFEMHRRNKKYAFTMIIPEIYWTVPNLFRYTKAFIREYGVKVGTLWKLFATNYDIL
FT                   KTDKGRDEFTDYENMVRDDLHQWVKFGGDVEPKLSEKVAIDHLLESETADDDVGLMFLV
FT                   NRARSKVPLIEDEFEGEEYNLCHFWSNFEIARLDVFDNEVYNSYFQYLEASGGFWKERW
FT                   GDAPVHSIGLALTLDVDDIHYFRDIGYMHSILKHCPKNSPDLNEFQYKPANKKYKRSSW
FT                   TRYDTPIEGGSGCRCRCPSKPAEVEDTITFCFEKWMDVTHLKKGEVELYQLFNIEEKEE
FT                   MVRNDFERHHQQQNQ"
     atgagggtaa aggtcaaaag gtgggtaaat gatgcagtag aggaagtatt agattggcta        60
     ttgtcaacca ttgcgatata tatgtatatt acagccatta tttgtgggac attcttatat       120
     tttacttacc cttctcgaac tgatatacga ttttactccg agcaggattt gggtaccgaa       180
     agagatgcac cattctacta tggttgtgtg aacacagagg gatatttaca agcaccagaa       240
     tataagaaga tgaatgcagc ctttgtcatg cttacgcgga ataacgaatt gaaggatgta       300
     ttgtcttcaa tgaatagcat tgaagcgcat ttcaatcaat ggtttaaata cccatacgtg       360
     ttcctgaatg acgaaccgtt cagcgaagaa tttaagaaat caatacgtga agctacagat       420
     gctgatatcg aatttggtac actagatgaa agtcaatggg agtttccaga agaagtaaga       480
     aacacattcg aatatcagaa tgccataacc gatcagggag acagaggtat cttgtatggt       540
     aatatggaat cataccataa gatgtgtcgg ttctattcgg gcatatttta caaacatcca       600
     ttgatgcaga aatatgaatg gtattggagg ttagaacctg atgtggagtt tttctgtgat       660
     ttgacatatg atccattttt tgaaatgcat agaagaaata aaaagtatgc attcaccatg       720
     attatacctg aaatttactg gactgtgccg aacttgttta ggtacacaaa ggcatttatt       780
     agagagtatg gcgtaaaagt ggggacactt tggaagcttt tcgcaacaaa ttatgatatt       840
     ctgaagaccg ataaaggaag agatgaattt actgactatg aaaatatggt tagagatgat       900
     cttcatcagt gggtaaaatt tggtggtgat gtggaaccca agttatcaga gaaggtagct       960
     atcgaccatt tacttgaatc ggaaactgca gacgatgacg tagggttgat gttcttggtg      1020
     aacagggcta ggtcaaaggt accactaatc gaagatgaat ttgagggaga agaatataat      1080
     ttatgtcatt tctggtcaaa cttcgagata gcaagattgg atgtttttga taacgaagtc      1140
     tacaacagtt atttccaata tttagaagct agtggtggtt tttggaaaga acgttggggg      1200
     gatgcaccag tacattctat tggattagca ttgactctag acgtagacga tatacattat      1260
     tttagagata ttgggtatat gcattccatt ttgaaacatt gtccaaagaa ctcacctgat      1320
     ttaaacgaat tccaatacaa gcccgctaat aagaaataca agaggagctc ctggactaga      1380
     tatgatactc caattgaagg gggtagcggt tgtcgttgta gatgtcctag taaaccggct      1440
     gaggtagaag atactatcac attttgtttt gaaaaatgga tggatgtgac acatttgaag      1500
     aagggagagg tagagctata ccaactattc aacattgaag agaaagagga aatggtgaga      1560
     aatgattttg aaaggcacca tcaacagcag aatcagtaa                             1599
//

If you have problems or comments...

PBIL Back to PBIL home page