(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE299

CAGLA1_12.PE299      Location/Qualifiers
FT   CDS_pept        complement(699260..700279)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000217621" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349249"
FT                   /gene_name="SSN8"
FT                   /locus_tag="CAGL0M06875g"
FT                   /product="RNA polymerase II holoenzyme cyclin-like subunit "
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62622.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG396776"
FT                   /db_xref="HOGENOM:HBG436057"
FT                   /db_xref="HSSP:1ZP2"
FT                   /db_xref="InterPro:IPR006670"
FT                   /db_xref="InterPro:IPR006671"
FT                   /db_xref="InterPro:IPR011028"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="InterPro:IPR015429"
FT                   /db_xref="UniParc:UPI00003B7104"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJE8"
FT                   /transl_table=1
FT                   /translation="MSGSYWTSMQRQKWQHTKPSLARERQRLWVMECQLFPQGLNIIVD
FT                   SKPNSADSSNGNAANNGGGNGRSQLVATTKNIPITHRDLHYDKDYNLRIYCYFLIMKLG
FT                   RRLNIRQYALATAHIYLSRFLLKASVREVNLYLLVTTCVYLACKVEECPQYIRTLVSEA
FT                   RSLWPEFIPPDPTKVTEFEFYLIEELQCYLIVHHPYKSMEQIVEALKEEPFKLTFTSDE
FT                   LQNCWSLINDSFINDVHLTYAPHIIAMACLFITVSIQGSNTKELSLTSAVTETLTSQSS
FT                   LTPQQQTFFRFLAESHVDLEEVMDTIQQQIILYDHWDRYHEPWIKYLLHTLYLRPLSA"
     atgtctggga gttactggac ttctatgcag cggcaaaagt ggcagcacac caagcctagc        60
     ttggcgcgcg agcgacagag gctgtgggtt atggagtgcc agttatttcc acaaggtctg       120
     aatattatag tggattccaa gcccaactcc gcagatagtt ccaacggaaa tgctgctaat       180
     aatggaggtg gcaatggtag gtcacaattg gtagccacga ctaagaatat ccctataaca       240
     catagagatt tgcattacga taaggattat aatttgagga tttactgtta tttcctcata       300
     atgaaactgg gcagacggtt aaacatacgg caatatgcct tggctactgc acatatatat       360
     ctttcacgat ttctattaaa agcttccgtc agagaggtca atttatatct attggtcact       420
     acatgcgttt atttggcttg taaagtggaa gagtgtccac aatatatcag gacattagta       480
     agcgaggcaa gatcattatg gccggagttt atacctcctg atcctacaaa ggtaacagaa       540
     ttcgaatttt acctgataga agaactacaa tgctacttaa ttgtacacca cccttataag       600
     tctatggaac agatagtgga agctttgaaa gaagagcctt tcaaactaac ttttacgtca       660
     gatgagctac aaaactgctg gtcacttata aatgatagct ttatcaatga cgtacattta       720
     acttacgcac ctcacatcat tgctatggca tgtctattca ttaccgtctc catacagggt       780
     tcaaatacta aggaattgtc attgacttct gcggtaactg agactttaac gtctcagtcc       840
     tccttgaccc ctcaacaaca aacttttttc agatttttgg ctgaatcaca cgttgaccta       900
     gaagaagtaa tggataccat ccaacaacag atcattcttt atgaccattg ggatcgttac       960
     catgagccat ggattaagta tctcctacat acactttacc taagaccact atctgcctga      1020
//

If you have problems or comments...

PBIL Back to PBIL home page