(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE30

CAGLA1_12.PE30       Location/Qualifiers
FT   CDS_pept        86290..89556
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19348719"
FT                   /locus_tag="CAGL0M00770g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="DNA binding"
FT                   /protein_id="CAG62355.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="HOGENOM:HBG124085"
FT                   /db_xref="InterPro:IPR001025"
FT                   /db_xref="UniParc:UPI00003B6FFE"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FK65"
FT                   /transl_table=1
FT                   /translation="MAELIKDLEGWQIIIKDQDGNVMDERDRKVRRKRNVSTDLFIFRE
FT                   KDALTFGRGQNVVVHDEVSDSYAVYLIHEIRQNTLNHALEILCFTYLRWFELEPRDYYK
FT                   EFKPEYLSMTNQQITEKFLEEIDRDEIYLTAEITPIWLKDFIDIAEVYNAKKWAQVRQS
FT                   VNKERNFLVRYVCEPVAENFVPVDIDNIMDQMRKRSARDFETMLKNLTVNGFVHSSSKK
FT                   RQKIKAEDTDNTVTKKNLLHNQKQKEPESHELKYQKVQLEDSPQPHHKKPQSRIDDHYS
FT                   VVSDMPHGRIVNTGVKPTTKKSSTSSQTQTDHTQKRKLQSDGGKSGPSNMKSTVGNGSS
FT                   NDNIQKKRKTEDSSKTPSNLHTTMTGVSRSTGVTSDAGKVVDKEIIKNPTSVPSQGGNR
FT                   TKGNDMSKKEPYSKAIAAANQLKAGRTNQKSNQTAKKPSTTSSNEREEKIPAYLSGRFQ
FT                   PSEVIDSVQSGTLNDLMTQVRKRGGVSEALKYKAKNHVDGTGQDLYATAKSFTSNLRRT
FT                   LLGSENSAQSQQQNASDIEKRKPYNVIDDFKNNSSAKILEHVKRGNTVSELLCHQPIDK
FT                   TPEKSNDEKLKPLLTALSDLTTNKQFVQLRNIVGLTAQSKNSGSIFEKLRKCTTSESLI
FT                   QCMSDSITSDIILSMRNKEFVTIYGSLFNAIINGRNKSLYLTGDDEYTIKYVFNKVAHE
FT                   LLLSATFEEIPQFKLASVPSSYDNFYQGLWQNISGDILSDTEAAIALDSYFSVMQPVQR
FT                   FPILIYIENMDEFFNNSETIYKDLINWFLNPLSKITLICNGTVVNNEIGNPLKDIFLHV
FT                   NFPSVSEEQDCSVANISKVINQINSSYFYFNADLQAATFCEFYKHYTKNWQKINFRINE
FT                   PEVGISVKNIQNALTLKGFDSIINVHKHIYQCLRNVVNRYIDSTAKKTTVDIQANQLSV
FT                   SAGSANTHYDLMEPLYGRIMSSLAELTFVDKLVLFCTVLCRLRKSSVEKIDLNEVYNVI
FT                   VDVLHHNCDNSPMISNLLLTYSTIKNRNDKGSAIKLFLSSLMWLDVFTRLYRTGFVTLH
FT                   VDQEDRNQIKVALAGFEVDSILAELKRDSSMSWIQSCLTE"
     atggctgagc ttataaaaga cctggaagga tggcagataa tcatcaagga ccaggatggt        60
     aatgtcatgg acgagcgcga ccggaaagta cggaggaaga gaaatgtctc gactgatctg       120
     tttatattcc gggagaaaga cgcacttact tttggccgtg gtcaaaatgt ggttgtgcat       180
     gacgaagtat ctgactcata cgcggtctac ttgatccacg aaatacgcca gaacaccttg       240
     aaccatgcgc tggagatact gtgtttcaca tatttgagat ggtttgaatt agaaccacgt       300
     gactactaca aggagttcaa gcccgagtat ctgtccatga ccaaccagca aattacagag       360
     aagttcctgg aggagatcga tcgcgatgag atatatctaa ctgctgaaat tacgccgata       420
     tggctcaagg atttcataga tattgccgaa gtttacaacg caaagaaatg ggcgcaggta       480
     agacaatcag ttaacaaaga gagaaacttc ttagtcagat atgtgtgcga acccgtagca       540
     gagaattttg tccctgtaga catagataac attatggatc agatgagaaa gcggtctgct       600
     cgcgattttg agacaatgct gaagaattta acagtcaacg gattcgtcca tagctcgagt       660
     aagaaaaggc aaaaaattaa ggctgaggat accgacaata ctgtaactaa gaagaatcta       720
     ctacataatc aaaaacaaaa ggaacctgaa tcacatgagc tgaaatatca gaaagtacaa       780
     ctagaagata gtccccaacc tcatcacaag aaaccgcaat caagaatcga tgatcattac       840
     agcgttgtga gtgatatgcc tcatggccgt atagtcaaca ctggcgtcaa gccaactaca       900
     aaaaagtcaa gcacgtctag tcaaacacaa actgatcaca ctcaaaagag gaaacttcag       960
     tctgacggag gcaaatcggg gcccagtaat atgaagtcaa cagtgggcaa tggtagttca      1020
     aatgataata ttcaaaaaaa acgtaaaaca gaggactcta gtaagacacc aagtaattta      1080
     cacacgacca tgactggtgt atctagaagt actggcgtta cttctgatgc tggtaaagtg      1140
     gtagataagg aaatcataaa aaatccaaca tcagtacctt cacaaggagg taatagaacc      1200
     aaagggaatg atatgagtaa gaaggaaccc tactcaaagg caatagctgc agcaaatcaa      1260
     cttaaagcag gcaggaccaa tcagaaatca aatcagacag ctaaaaaacc ttctacaaca      1320
     tctagcaatg aaagagaaga gaaaatacct gcttacttat caggccgctt tcaaccgtca      1380
     gaggtcattg actctgtcca aagtggcacc ctcaatgatt taatgaccca agtgagaaag      1440
     agaggtggtg tttcagaagc cttaaaatac aaagctaaaa accatgtcga tggaactggc      1500
     caggatttat atgccacggc aaagtcattt acatccaacc ttcgtagaac tttactaggt      1560
     tccgagaact cagctcaatc tcaacaacaa aatgccagcg atatagaaaa aagaaaacca      1620
     tataatgtaa tcgatgattt caagaataat agttcggcaa aaatactcga acatgttaaa      1680
     agaggtaata cagtatccga gcttctatgc caccaaccta ttgacaaaac acctgagaaa      1740
     tcaaatgatg aaaagttgaa gcctttactt actgccttat ctgatcttac aacaaacaaa      1800
     caatttgtgc aattacgcaa tattgtaggt ttgactgctc aatcaaagaa cagtggtagt      1860
     atctttgaga aattacggaa atgtaccact agtgaatccc taattcaatg tatgtcagac      1920
     tctatcacat ctgacatcat tctgtctatg agaaataagg agtttgtgac catttatggt      1980
     tctcttttta atgctattat aaatggtaga aacaaatcat tatatctaac tggtgacgat      2040
     gaatacacga tcaaatatgt tttcaataaa gttgcacatg aactattact atctgcaacc      2100
     tttgaagaaa ttcctcaatt taaactcgcc tctgtcccat cctcatatga taatttctat      2160
     cagggactat ggcagaatat ctccggcgat attctgtcag ataccgaagc agctatcgca      2220
     ttagattcat acttttctgt catgcagccg gtacagagat ttcctatttt gatatatatc      2280
     gaaaacatgg atgagttttt caataacagt gagacaatat acaaagacct tatcaactgg      2340
     tttttaaacc cactcagtaa gattacacta atttgtaacg gcacagtggt aaataatgaa      2400
     attggaaacc cactcaagga catattttta catgtgaact ttccctctgt atccgaggag      2460
     caagattgta gtgtagctaa catttcgaag gtgataaacc agataaactc ctcttatttt      2520
     tattttaatg cagatttaca agcagcaaca ttttgcgagt tttacaagca ctacaccaag      2580
     aattggcaga agattaactt tcgcattaac gaacctgaag ttggaatttc cgtaaaaaac      2640
     atacagaatg cgcttacatt gaagggtttt gattccatca tcaatgtaca caagcatatc      2700
     tatcaatgtt tgagaaatgt ggtaaacaga tatattgaca gcacggcaaa gaaaaccaca      2760
     gtagatatcc aagccaacca actgtcagtc tctgcaggct cagcaaatac ccactatgac      2820
     ttgatggaac cactatatgg ccgtattatg tctagtctcg cggaattaac ttttgtcgat      2880
     aagttagtat tgttctgtac tgtgttatgc aggctaagaa aatccagtgt cgagaaaatt      2940
     gaccttaacg aggtttacaa tgtaatcgtt gatgtgctgc accataactg cgataactct      3000
     ccaatgatct caaacctatt actgacatac tcaacgatca aaaaccgtaa cgataagggg      3060
     tctgccatca aactgttcct aagcagcctg atgtggctgg acgtcttcac ccgcctgtat      3120
     cgtacaggct ttgtaacatt acacgttgac caagaggacc gcaaccaaat aaaagtcgcg      3180
     cttgcagggt ttgaagtcga cagtattcta gccgagttga agcgcgacag ctcgatgagc      3240
     tggatccaat cgtgtctcac cgaatag                                          3267
//

If you have problems or comments...

PBIL Back to PBIL home page