(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE301

CAGLA1_12.PE301      Location/Qualifiers
FT   CDS_pept        complement(703702..706572)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000112499" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438985"
FT                   /locus_tag="CAGL0M06919g"
FT                   /product="Similar to uniprot|P53971 Saccharomyces
FT                   cerevisiae YNL023c FAP1"
FT                   /function="nucleic acid binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62624.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG190560"
FT                   /db_xref="HOGENOM:HBG397891"
FT                   /db_xref="InterPro:IPR000967"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="UniParc:UPI00003B7106"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJE6"
FT                   /transl_table=1
FT                   /translation="MQDGRTEVTQDEYRHYDDHPDNSSLVIGLSEDESEIETNMGAELS
FT                   EELSDLDEGDEKDMAYYEKAVQEIVKGDSYSCLICTVELDYTCKLYACEKCYRVYDYEC
FT                   IREWAEKSTSKRTDKLWACPNCFYTKKAIPKKNRPTCWCGEQVNPEPNPLNPNSCGQTC
FT                   NAKICSHGCSQICHLGPHQECTRMMSIKCSCGKVTKDIVCFQRRLYSKGFNCETVCDKL
FT                   LPCGIHKCNRKCHTGLCGSCPETIISKNTNMKIRCYCGQTSKDKIKCKDVRFPANAAYS
FT                   KDDKGQRWIGVFMCDKIRKVPYECGEHSFYEKCKAPPSISGRLICEFSPKKLKTCPCGK
FT                   NELTDLSKPRSKCTDAIPTCGQVCGKMLKCGKHKCPFACHLGDCMDPCTQIEKVRCACE
FT                   QKQFTIPCGFNDHARCNLKCESLMSCRRHRCTERCCAGRPLAERRRKTMKINVRDLADE
FT                   STIEPIHICLKDCNLTLSCGIHKCNRKCHAGKCPPCLESDSNDLVCPCGKTIVEAPVRC
FT                   GTKLPNCPYPCIRVVRGETDCGHSPMPHECHPPDIPCPDCTATVFKPCKCGKEQRVRTV
FT                   CFMKDVSCGKVCGERLQTCYHKCQKKCHEPGACQTVCKQTCNMPRLYCNHRCPKPCHKF
FT                   EECPDIPCTALVKITCPCGRIEKEVTCGVYSKNKEAQDSTRIVCDEECAVLQRHMQLKE
FT                   AFGIVDKPQNTHNEEMARLEQVISTASTFADLDLPFTEPVITTYIRHENWCTDIENTLN
FT                   KLIDDNNRTSLHFKPMRPPQRYFIRELAKAYNLYSESQDPEPNRSVFVKKNLDGSSTKP
FT                   ILSISEAAPLYQSYKKLEKEKKQANFESMTTTRLINFTPEMSPELESAARFNGFLVTNV
FT                   GEFTSTDDLQNLFAPYLKSTLVVEPQFQILPERKQAVIYPNKYKEISINVERDMETLVQ
FT                   HFDFLIKESLLAGGVELCNIENVLAE"
     atgcaagatg gtcgaacaga ggtaactcag gatgaatata gacattatga tgatcatcct        60
     gataatagtt ccttagttat cggattgtca gaagatgaaa gtgaaattga aacaaacatg       120
     ggagcagaac tatctgaaga gttaagcgat cttgatgaag gtgacgagaa agatatggca       180
     tattatgaaa aggcagtaca agaaattgta aaaggtgaca gctatagttg tttgatctgt       240
     actgttgaat tggattacac ttgtaagctt tatgcgtgtg aaaagtgtta tcgtgtgtat       300
     gattatgaat gcataagaga atgggctgaa aaatctacat ccaagagaac agataagtta       360
     tgggcatgtc ctaactgttt ctatacaaag aaagcaattc ctaagaagaa tagacctaca       420
     tgctggtgtg gagaacaagt taatccagaa ccaaatccgt taaatccaaa ttcatgtggc       480
     caaacatgta acgccaaaat ttgtagccac ggttgttctc agatatgtca tctaggccct       540
     catcaggaat gtactcggat gatgagtata aaatgttcat gtgggaaagt aactaaagac       600
     attgtatgtt ttcagagaag attatactca aaagggttta attgtgaaac tgtttgtgac       660
     aaattactgc cttgtggaat ccataaatgt aacagaaaat gccacacagg tttgtgcggc       720
     agttgtcccg aaactattat atcaaaaaac actaatatga agataagatg ctattgtggt       780
     caaacaagta aagacaaaat aaagtgcaag gacgtcagat ttcctgccaa tgctgcatac       840
     tccaaagatg acaaaggtca acgatggata ggagtgttta tgtgcgataa gataagaaaa       900
     gttccatatg aatgtggcga gcactcattt tatgagaaat gtaaagctcc accatccatt       960
     tctggaagat tgatctgtga gttctcgccc aaaaagctga agacatgccc atgcggtaag      1020
     aatgaattaa ctgatctttc aaaacctagg tcaaaatgta cagatgctat acctacttgt      1080
     ggtcaagtat gtggtaaaat gctaaaatgc ggaaaacaca aatgcccgtt cgcatgccat      1140
     ttgggagatt gtatggaccc ttgcactcag attgagaaag taagatgcgc ttgtgaacaa      1200
     aaacaattca caattccgtg tggtttcaat gatcatgcga gatgtaatct caaatgtgaa      1260
     tctctaatgt cttgtagaag acacagatgt actgagaggt gttgtgcagg gagaccttta      1320
     gctgaaagga gacgtaaaac tatgaagatc aatgttagag atttagccga tgaatcaacg      1380
     atagaaccaa tccacatctg tttaaaagac tgtaatctaa cactttcatg tggaatacac      1440
     aagtgtaata gaaagtgcca cgcaggaaaa tgccctcctt gccttgaaag tgactcaaat      1500
     gaccttgttt gtccttgcgg caaaacaatt gtggaggcac ctgttagatg tggaactaag      1560
     ttgccaaatt gtccatatcc atgtattaga gttgttagag gagaaacaga ttgtggccat      1620
     tcgcctatgc cgcatgaatg ccatcctcct gacattccat gtcctgattg tacggcgact      1680
     gtctttaaac catgcaaatg tggcaaagag caaagagtaa ggacagtatg ctttatgaaa      1740
     gacgtttcat gtggtaaagt atgtggtgag cgcctacaaa cttgctacca taaatgtcaa      1800
     aagaaatgtc acgaaccagg ggcatgccag actgtttgta agcagacttg caatatgcct      1860
     aggctatatt gtaaccacag atgtcctaaa ccttgtcaca agtttgagga atgcccagat      1920
     attccatgca cagcattggt caaaattacc tgtccttgtg gtcggataga gaaagaagtg      1980
     acttgcggtg tatattcgaa gaataaagaa gcacaggact caacgagaat tgtatgtgat      2040
     gaagaatgtg cggtattgca aagacacatg caattgaaag aagcattcgg tatagtggac      2100
     aaaccgcaaa atactcataa cgaagaaatg gccagattgg aacaggttat ttccacagct      2160
     tctacttttg cagatttaga tctgccgttt acggaaccag ttataactac atatattcga      2220
     catgagaatt ggtgtactga tatcgagaac accctgaaca aattgattga tgacaataac      2280
     aggactagtt tacatttcaa accaatgaga ccccctcagc gttatttcat tagagaactt      2340
     gctaaggcat acaacctgta ttctgaatca caggatccgg aacctaatag gtctgtattt      2400
     gtaaagaaaa atttggatgg tagtagtacc aaacctatac tttcaatatc cgaggcagct      2460
     cctttatacc aatcttataa gaaattagaa aaggagaaga agcaggccaa ctttgagtcc      2520
     atgacgacaa ctagattaat taatttcaca cctgagatgt cacctgagtt agaatctgct      2580
     gccagattca atggtttttt ggttactaat gtaggcgaat tcacatccac agatgacttg      2640
     cagaatttat ttgccccgta tctgaaatct acactcgtgg tggaacctca gttccaaatt      2700
     ctaccagaga gaaaacaagc agttatctat ccaaataaat acaaggagat atctatcaat      2760
     gtagaaagag atatggaaac tttagtacag cattttgatt ttttgataaa ggagagctta      2820
     ctagcgggag gtgttgaact ctgcaacata gagaatgtat tagcggaata a               2871
//

If you have problems or comments...

PBIL Back to PBIL home page