(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE303

CAGLA1_12.PE303      Location/Qualifiers
FT   CDS_pept        709544..710338
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000256285" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349250"
FT                   /locus_tag="CAGL0M06963g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="6-phosphogluconolactonase activity"
FT                   /biological_process="pentose-phosphate shunt"
FT                   /protein_id="CAG62626.1"
FT                   /db_xref="GO:0006098"
FT                   /db_xref="GO:0017057"
FT                   /db_xref="HOGENOM:HBG398862"
FT                   /db_xref="HOGENOM:HBG725991"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="UniParc:UPI00003B7108"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJE4"
FT                   /transl_table=1
FT                   /translation="MTTAAPKLIQFDDEREVACATTEQIIKSQNSKLRQPVKKRTRREN
FT                   RFRLAISGGQLMQTLLKALLYRKEEIEWEKWDIFFVDERLVPFNSNESNYGQLKRGLLD
FT                   PLKSINYPQPNVYHIEETEIDDANVVAQTYEKQLINIFASRDSVRLPTFDMILLGCAPD
FT                   GHIASLFPQCHHNLREEMAWVIPITDAPLEPTKRISMSVPVISNSNQIIFMVTGSNNAE
FT                   LMKMIIEKPSCELPSALISTCAPGRVSWYVENEALKEVMLLD"
     atgactactg cagctccaaa attgattcag tttgatgatg aaagagaagt tgcttgtgct        60
     accaccgagc aaatcataaa aagtcaaaat tctaaacttc gtcaaccagt gaagaaaaga       120
     acaagaagag agaataggtt taggctggca atatcgggtg gacaattgat gcagacgctt       180
     ttaaaggcac tgctatatag gaaagaagaa attgaatggg aaaaatggga tattttcttt       240
     gtcgatgaga gattggtccc attcaactcc aatgaaagta attatggtca actaaaaaga       300
     ggattacttg atccactaaa atcaataaat tatccacaac cgaatgtata ccatattgaa       360
     gagacagaaa tagatgatgc taacgtagta gcacaaacgt atgaaaaaca attgattaat       420
     atttttgctt ctagagattc tgtaaggcta cctacctttg acatgatatt actgggttgt       480
     gcccctgatg gtcatatcgc atctttgttt ccccaatgtc atcacaattt aagagaggaa       540
     atggcatggg ttattccaat tacagatgca cctttggaac caacaaagag aatatccatg       600
     tccgtaccag taatttcaaa ctcgaatcag ataatattta tggttactgg tagtaataat       660
     gcggaactaa tgaaaatgat aattgagaaa ccttcttgcg aattgccaag tgcattaatt       720
     agtacatgtg cacctggtag ggtatcttgg tatgttgaga atgaagcttt gaaggaagta       780
     atgctacttg attga                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page