(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE307

CAGLA1_12.PE307      Location/Qualifiers
FT   CDS_pept        complement(713658..716174)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246501" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438988"
FT                   /locus_tag="CAGL0M07029g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62629.1"
FT                   /db_xref="HOGENOM:HBG190380"
FT                   /db_xref="HOGENOM:HBG396972"
FT                   /db_xref="InterPro:IPR019167"
FT                   /db_xref="UniParc:UPI00003B710B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJE1"
FT                   /transl_table=1
FT                   /translation="MSQRRRESALNFEETYNGFGEHELEENDYLNDETFGADIEVGTDF
FT                   DFGHPGKAATNNNVPAQASVMPQRSYVTAASSGINKPGQQNVDASMDLKPMESLWGGQT
FT                   EARPEEPVLSMEEIERQQRQMQQQQHQGPHGPMPPMPMMPPNMPPPNMAMPPPGYGPMP
FT                   GYQYPMNVNPSMFQGPPPPNMAMPPMQPSQGGQPMQPGQGGQPMQPPQRMPMPHQPEPP
FT                   VQSPMSAVQQSSGVSTPQQSVISSSASPANSNQAALHQEQGQQNLAFQQDEQSQQHQQQ
FT                   QQYYQRNRFNNQNNNRGNQRREPLSPEEKMRLQIRHAKVEKILKHAGLMTPRDKDFITR
FT                   YQLSQIVTEDPYNEDFYFQVYKLIQRGGVAAESNKGLIARAYLEHSGHRLGGRYKRADI
FT                   ALQRMQSQVEKAVTVAKERPQKNKDVDSVREGVLGKISTTMNSKAPRRQLAIPSHKSNE
FT                   DIAFSDDGKLSRDSTPALEEVTRNLDSVDLNAHSRTRRRSSYAFSSIDHNSVLSRSGGR
FT                   KFVLSLIETVYEEVLDLEANLRNDKETDSTALWETLHIDDEVYEVCPFISMLSFDKGVK
FT                   IIPRIFNFLSKQQKLKLLQKFFSELSHLNIIILSSYKTNPDPTESQLKKMDLFQTVFLK
FT                   IIVSFLSSSSSFIEIMGLLLYLIKNNNVSFISTSKIGLNLITVLISRAALIRQDSNRSN
FT                   VLSSPEISTWNEIYDKLFTALESKLSAVFPPKEYCDKVVKIQTANAGLSLAANPVSNKF
FT                   YDQAYIWQFLASLALSGKLNHQRIIIDEVRDEIFGTINTAEQLKKLPTEDQNGSLYRRE
FT                   KLYQDLNLFLNVMGLVSRDGEIMELK"
     atgagtcaga gaagaagaga gagtgctcta aattttgaag aaacctataa tggttttgga        60
     gaacatgagc tggaagagaa cgattacttg aatgacgaga ccttcggtgc agacattgaa       120
     gttggtaccg attttgattt cggccaccct ggcaaggctg ccactaacaa taatgttcct       180
     gcacaagcaa gtgtcatgcc tcaaagatcc tatgttaccg cggcatcatc cggtattaat       240
     aagccaggtc aacaaaatgt tgatgcctca atggatttga agccaatgga gtcattgtgg       300
     ggtggacaaa ctgaagcaag accggaagag cctgtattgt caatggagga aattgagaga       360
     cagcaacgtc agatgcaaca acagcagcat caaggtccac atggcccaat gcctccaatg       420
     cccatgatgc ccccaaacat gcctcctcca aacatggcca tgcctcctcc aggttatggt       480
     cctatgccag gttatcaata tccaatgaat gtcaatccta gcatgttcca aggcccacca       540
     cctccaaata tggctatgcc tcctatgcag cctagtcaag gtggtcagcc tatgcagcct       600
     ggtcaaggtg gtcagcctat gcaaccacct cagaggatgc caatgcctca ccaacctgag       660
     ccacctgttc agtctcctat gtcagctgtt caacaatcct ccggtgtttc aactcctcaa       720
     cagtcagtga tctctagttc ggcatcacca gctaatagta atcaagcagc tctgcatcaa       780
     gaacaaggcc agcaaaacct agctttccaa caagatgaac aaagccagca acatcaacaa       840
     caacagcaat actaccaacg taatagattc aataatcaaa acaacaacag aggaaatcaa       900
     agaagagagc cattgtctcc tgaagagaaa atgagattgc aaattcgcca cgccaaggtt       960
     gaaaagattt tgaagcatgc tggtttgatg actccaaggg acaaggattt cattacacgt      1020
     tatcaactat cccaaattgt cactgaggat ccgtacaacg aggacttcta tttccaggtt      1080
     tataagttaa ttcaaagagg aggtgttgct gctgaaagca acaaaggtct aattgccaga      1140
     gcttacttag agcattccgg tcatagatta ggtggtagat acaagcgtgc tgatattgct      1200
     ttgcagagaa tgcaaagtca agttgaaaag gcggttactg ttgccaagga aagacctcaa      1260
     aaaaataagg acgttgacag cgtccgtgaa ggtgtcttgg gtaagatttc cacaactatg      1320
     aacagtaaag caccaagaag acaattggcc attccatccc ataaatcaaa cgaagatatt      1380
     gcattctctg atgatggtaa gctttctcgt gattcaactc cagcccttga agaagttact      1440
     aggaacctag acagtgttga tttgaacgcc cactcgagaa ctagaagaag atcatcatat      1500
     gccttctcct ctatcgacca caactcagtc ctaagccgtt caggtggtag aaagtttgtt      1560
     ctttctttaa tcgaaactgt ttatgaagag gttttggact tggaagctaa cttgagaaat      1620
     gataaggaaa cagatagcac tgcattgtgg gagactcttc atattgatga tgaagtctat      1680
     gaggtttgtc cattcatttc aatgctatcc tttgacaaag gtgtgaaaat tattccacgt      1740
     attttcaact ttttgagtaa gcaacaaaaa ttgaagctac tccaaaagtt cttcagtgaa      1800
     ttatctcatt taaacatcat tatcttgagt tcatataaga ccaatccaga ccctactgag      1860
     tctcaactaa agaaaatgga tttattccaa actgttttcc taaagattat agtttccttc      1920
     ttatcctcca gctccagctt tattgaaatt atgggtttat tgttgtattt gattaagaat      1980
     aacaacgtct cattcatttc tacatcaaag attggtctaa acttaataac tgtgttaata      2040
     tcaagagcag ctttgattag acaagactct aacagaagta atgttttgtc atctccagaa      2100
     atttctacat ggaatgaaat ttacgacaaa ctattcacag ctttggaaag taagctatct      2160
     gcagttttcc cacctaaaga atattgtgat aaagtcgtta agattcaaac tgcaaatgct      2220
     ggtctttcac tagcagctaa ccctgttagt aacaagttct atgatcaagc atatatatgg      2280
     caatttttgg cttctctggc attaagtggt aagctaaatc accagcgtat aataatagat      2340
     gaggtcagag atgagatatt tggcactatt aataccgctg agcaattgaa gaagctacct      2400
     actgaagatc aaaatggctc gttgtacaga cgagaaaagc tgtaccagga cctaaattta      2460
     ttcttgaacg ttatgggctt ggtatcaagg gatggtgaga tcatggaatt aaaatag         2517
//

If you have problems or comments...

PBIL Back to PBIL home page