(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE313

CAGLA1_12.PE313      Location/Qualifiers
FT   CDS_pept        complement(723774..724271)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000239674" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349253"
FT                   /gene_name="EGD2"
FT                   /locus_tag="CAGL0M07161g"
FT                   /product="Nascent polypeptide-associated complex subunit
FT                   alpha"
FT                   /biological_process="protein transport"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="cytoplasm"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62635.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG236848"
FT                   /db_xref="HOGENOM:HBG628290"
FT                   /db_xref="InterPro:IPR000449"
FT                   /db_xref="InterPro:IPR002715"
FT                   /db_xref="InterPro:IPR016641"
FT                   /db_xref="UniParc:UPI00003B7111"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJD5"
FT                   /transl_table=1
FT                   /translation="MAEIPEGANVTILNRNEKKARELISKLGLKKVPGIIRVTFRKKDN
FT                   QIFAIEKPEVFRSVGGNYVVFGEAKVDNFTQRLAAAQQQAQSQTATKTPEDIQADMQAA
FT                   AVANENKTEGDAAEEDVDAGDLSNDDIDLVVQQTNATKGQAIKALKEHNGDIVNAIMSL
FT                   SK"
     atggctgaga ttccagaagg tgctaacgtt actattttga acagaaacga gaagaaggct        60
     agagagttga tctccaagct tggtttgaag aaggttccag gtatcatcag agttacattc       120
     agaaagaagg acaaccaaat ctttgccatt gagaagccag aagtcttccg ttctgttggt       180
     ggtaactacg ttgtcttcgg tgaagccaag gttgacaact tcacccagag attggctgct       240
     gctcaacaac aagctcaatc ccaaactgcc accaagaccc cagaggatat ccaagctgac       300
     atgcaagccg ctgctgttgc caacgagaac aagactgagg gtgacgctgc cgaggaagac       360
     gtcgacgctg gtgacttgtc caatgacgac atagacttgg tcgtccaaca gactaacgcc       420
     accaagggcc aggccatcaa agcgctgaag gaacacaacg gtgatatcgt caacgctatc       480
     atgtccttgt ctaagtga                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page