(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE318

CAGLA1_12.PE318      Location/Qualifiers
FT   CDS_pept        731627..732076
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000095211" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438994"
FT                   /locus_tag="CAGL0M07271g"
FT                   /product="Glutaredoxin"
FT                   /function="electron carrier activity"
FT                   /function="protein disulfide oxidoreductase activity "
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="CAG62640.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0015035"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG326260"
FT                   /db_xref="HOGENOM:HBG728471"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="UniParc:UPI00003B7116"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJD0"
FT                   /transl_table=1
FT                   /translation="MFATRLLGKSALLGTTSTRMVFRSQMARYMSTETKKAIEGAIASA
FT                   PVVLFMKGTPEFPQCGFSRATISMLGQQGVDPEKFAAYNVLEDPELREGIKEFSNWPTI
FT                   PQLYVNKEFIGGCDVITSMARSGELADVLEEANALVPEEKEEGTD"
     atgttcgcta caagattatt aggaaagagt gctttattgg gcaccaccag tactaggatg        60
     gtgttcaggt cacaaatggc acgttacatg agtactgaga ccaagaaagc tattgaaggt       120
     gctattgcat ctgctcctgt tgttctattc atgaaaggta cacctgagtt tccacaatgt       180
     gggttttcta gggccaccat ctcgatgctt ggtcagcaag gtgttgatcc agagaagttt       240
     gccgcatata atgtcttgga agacccagag ttacgtgaag gtatcaagga gtttagcaac       300
     tggccaacca ttccacagct gtatgttaac aaagaattta tcggtggttg cgatgttatc       360
     actagtatgg cccgttctgg tgaattagca gatgtactgg aagaggcaaa tgcattagta       420
     ccagaagaga aagaggaagg aactgactaa                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page