(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE319

CAGLA1_12.PE319      Location/Qualifiers
FT   CDS_pept        complement(733072..737619)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162078" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196077"
FT                   /locus_tag="CAGL0M07293g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ATP binding"
FT                   /function="ATPase activity, coupled to transmembrane
FT                   movement of substances"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAG62641.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0042626"
FT                   /db_xref="HOGENOM:HBG059517"
FT                   /db_xref="HOGENOM:HBG323792"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010929"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniParc:UPI00003B7117"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJC9"
FT                   /transl_table=1
FT                   /translation="MPASISSSIISKERKDDADTTSNSYADSVHSYENINRDDNEQQPV
FT                   STQLSRHLTQILSEEGGKERLESMARVISTKTKAEMDKFEVNDMDFDLRMLLNYLRNRQ
FT                   LEQGIEPGDSGVAFKNLTAVGIDASAAYGPSVEEMLRDTGKLPLTLINKLRRKKDSVPL
FT                   RNIIQNCTGVVESGEMLFVVGRPGAGCSTLLKCISGETSELVSVDGEFSYDGLDQEEMM
FT                   KNYKGYVIYCPELDFHFPKITVKETIDFALKCKTPRVRIDRMTRKQYVDNIRDMWCTVF
FT                   GLRHTYATKVGNDFVRGVSGGERKRVSLVEAQAMNASIYSWDNATRGLDASTALEFAQA
FT                   IRTATNMMNNSAIVAIYQAGENIYELFDKTTVLYNGKQIYFGPAKKAVQYFENMGWIKP
FT                   PRMTSAEFLTSVTVDFENRTLDIKPGYEDTIPKSGFEFEEYWLNSPEYQELLRHYDDYH
FT                   ARHPAEETRERFDTAKKQMLQSGQRESSRYVVNYWSQVWYCMIRGFQRVKGDSTYTKVY
FT                   LSSFLIKGLIVGSMFHKIDNKSQSTTAGAYSRGGLLFYVLLFASVTSLAEIANSFSTRP
FT                   IIVKHKSYSMYHISAESLQEIITELPTKFVAIIVLSLVTYWIPYLKFEAGAFFQYILYL
FT                   FTVQQCTSFIFKFVATITKDGVTAHAIGGLWVLMLCVYAGFVLPLGEMHHWIKWLHFLN
FT                   PLTYAFESLVSTEFHHREMLCSQLIPSGPGYENVSVANQICNAAGAIKGHMFVNGDTYI
FT                   DRQYHFAYRHAWRSWGVNIVWTFGYIVFNVILSEFIKPVSGGGDLLLYKRGHMPEFGTE
FT                   NADARVASREEMMETLNGPDVDLPKVIAAKDVFTWNHLNYTIPYDGATRQLLSDVFGYV
FT                   KPGKMTALMGESGAGKTTLLNVLAQRINMGVITGDMLVNSQSLPASFNRSCGYVAQADN
FT                   HMAELSVRESLRFAAELRQPRSVPLEEKYEYVEKIIALLGMQNYAEALVGKTGRGLNVE
FT                   QRKKLSIGVELVAKPSLLLFLDEPTSGLDSQSAWSIVQFMRALADSGQSILCTIHQPSA
FT                   TLFEQFDRLLLLKKGGKMVYFGDIGENSSTLLNYFERQSGVKCGISENPAEYILNCIGA
FT                   GATASASADWHDLWQQSPECAAARAELDELHKNLLSRPVTEDPELVTKFAASYTTQMKC
FT                   VLRRTMIQFWRSPVYIRAKFLECVSCALFVGLSYIAVNHSVGGATEAFSSIFMLLLIAL
FT                   AMINQLHVFAYDSRELYEVREAASNTFHWSVLLLCHYVVETGWSTLCQFMCFICYYWPA
FT                   GYSGRASHAGFFFFFYVLIFPMYFVSYGLWILYMSPDVPSASMINSNLFAAMLLFCGIL
FT                   QPKEKMPGFWRGLMYNVSPFTYVVQALVGPLVHDKKVVCNKNEFAIMDPPAGQTCGEYL
FT                   RTYIGNNSGYLVNPQATSNCNYCPYSVQDEVVARFNVKWSYRWRNFGFMWVYICFNIFA
FT                   MLSCYYIMRVKVWSLKSVLDFKKWFNGPRKDRHEKDKSIFEKKPGDEEKVKQKF"
     atgcctgctt caatatcctc ttcgataata tcgaaggaaa ggaaggatga tgcagatact        60
     acatcaaatt catatgctga ttctgtgcat agttatgaaa acataaatcg tgacgataat       120
     gaacagcaac ctgtttcaac acaattatct cgtcacttaa cccaaattct ctcagaagaa       180
     ggtggtaaag aaagattgga gtccatggcc agagttatct ccaccaagac aaaggctgaa       240
     atggacaaat ttgaagtcaa tgacatggac ttcgacttga gaatgctgtt gaattaccta       300
     agaaatagac agcttgaaca aggtatcgaa ccaggtgact ccggtgttgc ttttaaaaat       360
     ctaaccgcag ttggtataga tgcttccgct gcctatggtc caagtgtgga ggaaatgtta       420
     agagataccg gtaaactacc acttacactg atcaacaagc taagaagaaa gaaagatagt       480
     gttcctttga gaaacattat ccaaaactgt actggtgttg ttgaatctgg tgaaatgtta       540
     tttgtggttg gtagaccagg tgctggttgc tcaacattgc taaaatgtat ctctggtgaa       600
     acctcagaat tagttagcgt tgatggtgaa ttttcctatg atggtttaga tcaagaggaa       660
     atgatgaaga actacaaagg ctatgtcatt tactgtccag aacttgactt ccacttccct       720
     aaaatcacag tgaaagaaac cattgatttt gcactaaaat gtaaaactcc tagagttaga       780
     attgacagaa tgaccagaaa acagtatgtc gataatatta gagatatgtg gtgtactgtt       840
     tttggtttaa gacatacata cgctactaaa gtcggtaatg attttgttag aggtgtctct       900
     ggtggtgaaa gaaagcgtgt gtctttagta gaagctcaag cgatgaatgc ttctatttac       960
     tcctgggata acgcaaccag aggtttagat gcttctacag ctttagaatt tgcacaagct      1020
     attagaacag ctaccaacat gatgaataat tcagctattg ttgctattta ccaagcgggt      1080
     gaaaacatct atgaactatt tgataaaacc acggttttgt ataatggtaa acaaatttac      1140
     ttcggtccag ctaagaaagc tgtgcaatat tttgagaata tgggttggat aaaaccacct      1200
     agaatgacat ctgctgagtt tttaacctct gttactgttg actttgaaaa tagaacttta      1260
     gatatcaaac ccggttatga agatacaatt cctaaatctg gttttgagtt tgaagaatat      1320
     tggttgaact ctcctgaata ccaagaacta ttgagacact acgatgatta ccatgccaga      1380
     caccctgctg aagaaactag agaaagattt gacactgcaa agaagcaaat gcttcaatca      1440
     ggtcaacgtg aaagctcccg ttatgttgtc aattactggt ctcaggtttg gtactgtatg      1500
     atccgtggtt tccaaagagt taaaggtgac tctacttata caaaagtcta cctaagttcc      1560
     tttttaatca aaggtttgat tgttggttca atgtttcata aaattgataa taaaagtcaa      1620
     tccaccacag cgggcgctta ttcacgtggt ggtttgctat tttatgttct attgtttgcc      1680
     tccgttactt ctcttgctga aattgctaac tctttctcta ctagacccat tattgtgaaa      1740
     cataaatcat actcgatgta ccacatttct gcagagtctc tccaagaaat tatcacagag      1800
     ttgccaacca aatttgttgc aattattgtt ttatctttag tgacatactg gataccatac      1860
     ctgaaatttg aagctggtgc atttttccaa tacatcttgt atttattcac tgtacaacaa      1920
     tgtacttcat ttatctttaa atttgtcgct acaattacaa aagatggtgt tactgcacac      1980
     gctattggtg gtctatgggt tttgatgtta tgtgtttatg ccggttttgt gttaccatta      2040
     ggtgaaatgc atcattggat taaatggctg catttcctaa atccactaac atatgcattt      2100
     gagagtttag tatcgaccga attccaccat agagaaatgc tttgtagtca attgattcca      2160
     agtggtccag ggtatgaaaa tgtttccgtt gctaatcaaa tttgtaatgc tgctggtgct      2220
     ataaaggggc atatgtttgt gaatggtgat acgtatattg atagacagta ccattttgca      2280
     taccgccatg cctggagaag ttggggtgtc aatattgttt ggacatttgg ttatattgtt      2340
     ttcaatgtta ttctttcgga gtttatcaaa ccagtatctg gtggtggtga tttgttattg      2400
     tacaagagag gccacatgcc agagtttggt actgaaaatg ctgatgctag agttgctagt      2460
     agagaagaaa tgatggaaac tttaaatggt ccagatgttg atttgccaaa ggttatcgct      2520
     gctaaggatg tctttacatg gaaccacttg aattatacta ttccttatga tggtgccacc      2580
     agacaattat tatcagatgt ttttggttac gttaagcctg gtaagatgac agcactaatg      2640
     ggtgagtcag gtgctggtaa aaccacttta ctaaacgttt tggcccaaag aattaatatg      2700
     ggtgttatta ctggtgatat gttagttaat tctcagtcac tacctgcatc ttttaataga      2760
     tcgtgtggtt atgttgctca agcggacaat catatggctg aattgtcggt tagagagtct      2820
     ttgagatttg ctgctgaatt aagacaacct agatctgttc cattagagga aaaatatgag      2880
     tatgttgaaa agattatcgc cttgttgggt atgcaaaatt atgccgaagc tttagttggt      2940
     aaaacaggta gaggtctaaa tgtggaacaa agaaagaagt tgtcaattgg tgtggaatta      3000
     gttgccaagc cttccttatt actattcttg gatgaaccaa cgtctggttt ggattctcaa      3060
     tcagcttggt ccattgtcca atttatgaga gcattggctg actctggtca atctattttg      3120
     tgtactattc atcaaccttc tgcaactttg tttgaacaat tcgacagatt actgttgctg      3180
     aaaaaaggtg gtaagatggt ttactttggt gatattggtg aaaattcatc tactttgtta      3240
     aactattttg agcgccaatc cggtgtgaag tgtggtattt cagagaatcc tgcagagtat      3300
     attctaaact gtatcggtgc aggtgctact gctagtgcat ctgctgactg gcacgatcta      3360
     tggcagcagt cacctgaatg tgcagcagcc agggctgaat tggatgaact tcataaaaac      3420
     cttttgtcaa gacctgttac cgaagatcct gaacttgtaa caaaatttgc ggcctcatac      3480
     acgacccaaa tgaaatgtgt tttaagaaga accatgatac agttctggag atcaccagtg      3540
     tatattaggg ctaagttctt ggaatgtgtg tcatgtgctt tgtttgttgg tttgtcgtat      3600
     atcgctgtca accactctgt tggtggtgca actgaagcct tttcatctat ctttatgtta      3660
     ttgttgattg ccctagcaat gatcaatcaa ttacatgtct ttgcttatga cagtagggaa      3720
     ttatatgagg ttagagaagc tgcgtctaac actttccatt ggagtgttct attgttatgt      3780
     cactacgttg ttgagacagg ttggtctaca ctatgccaat ttatgtgttt catttgttac      3840
     tactggcctg ccggatatag tggacgtgct tcgcatgcag gattcttctt cttcttctat      3900
     gttttgattt tcccaatgta ttttgtttca tatggtctgt ggattttgta catgtctccc      3960
     gatgtgcctt cagcttctat gatcaattca aacttatttg cagccatgtt acttttctgt      4020
     ggtatcttac aaccaaagga aaaaatgcca ggattctgga gaggtttgat gtacaacgtt      4080
     tctccattca catatgttgt tcaagcatta gttggcccat tggtacacga taagaaggtt      4140
     gtatgtaaca agaatgagtt tgcaatcatg gatccacctg cagggcaaac atgtggcgag      4200
     tatctaagaa cttatattgg taacaactca ggttacttag ttaatcctca agctacgagc      4260
     aattgtaact actgcccata tagtgttcaa gatgaagttg ttgcccggtt caacgtgaaa      4320
     tggagttaca gatggagaaa ctttggtttt atgtgggtct acatctgctt caacattttt      4380
     gccatgttgt cttgttatta catcatgaga gttaaggttt ggagcttgaa atctgtcctt      4440
     gactttaaga aatggttcaa cggaccaaga aaggatagac atgaaaaaga caagtctatc      4500
     tttgagaaga aaccaggtga tgaagaaaaa gtgaagcaaa aattttaa                   4548
//

If you have problems or comments...

PBIL Back to PBIL home page