(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE320

CAGLA1_12.PE320      Location/Qualifiers
FT   CDS_pept        complement(740469..741557)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200927" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501421"
FT                   /locus_tag="CAGL0M07315g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62642.1"
FT                   /db_xref="HOGENOM:HBG396429"
FT                   /db_xref="HOGENOM:HBG433971"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="UniParc:UPI00003B7118"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJC8"
FT                   /transl_table=1
FT                   /translation="MKREVAYLAITNAFLVFFILFYTFDLLTLCIDDTIHDTLTASDLN
FT                   SSVPREDELIPRIIHQTYKTEDIPKHWIEGQHRCQELHSDYQYIMWTDQMALDFITEHY
FT                   SWFLPTFVGYKRPIQRADAIRYFILYHYGGIYIDLDDKCERPLDNLLKLPAFVRKTSPL
FT                   GISNDVMGSMPGHPFFWKAIHNLNHYNKNWYVPYLTIMSSTGPLFISIVWKHYRRWKIF
FT                   TKNYVPVKIIQPQDYKGSSSSFFSIVKGSSWHTDDAKWMKSLENHILSCVVAGFIFAFF
FT                   ILYGEYIFYCWLCYKKPITLTNSDSGSKNSWSSKLLWVWNRIKFRSSSYTTTYPTTPTT
FT                   SPKRSRKDSNAVFDIEKRTVNV"
     atgaaacgag aagttgcata cttggctatc acgaatgcct tcttagtttt cttcatattg        60
     ttctacacat ttgatttgct tacactgtgt atagatgaca ctattcatga tactctaacc       120
     gcatctgacc tgaactccag tgtgcctagg gaggatgagc taatacctag aattatccac       180
     cagacctaca agacagagga tatcccaaaa cactggattg agggacagca cagatgccag       240
     gagctacatt ctgattatca gtatatcatg tggactgacc agatggctct agactttata       300
     accgagcatt acagctggtt cttacccacc tttgtgggct acaagagacc aatccagcga       360
     gcagatgcaa ttagatactt tattctttac cactacggag gtatctacat cgacctcgac       420
     gacaaatgtg agagaccttt ggacaactta ttaaagttgc cagcgttcgt gagaaaaaca       480
     tcccctctgg gtatctctaa cgacgtgatg ggctcaatgc cgggtcaccc attcttctgg       540
     aaagccatcc acaatttgaa ccattacaac aaaaactggt acgtgccata tttgacgatt       600
     atgtccagta cggggccttt gttcatctcc atcgtgtgga aacattaccg tagatggaag       660
     atctttacca agaactacgt acccgtgaag atcatacaac cacaggacta caaggggtca       720
     tcctcctcct ttttttctat agttaagggg tcctcctggc acacagatga tgccaagtgg       780
     atgaagtctc tggaaaacca catcctatct tgtgtggttg caggattcat atttgccttc       840
     ttcatcctat acggggagta catcttctac tgctggttat gttataagaa accaatcaca       900
     ctaactaatt cagacagtgg gagtaaaaac tcatggagct cgaaattact atgggtttgg       960
     aacaggatca agttcagatc atcaagttac acaactactt accccactac accaacaact      1020
     agcccaaaga gatctaggaa ggactcaaac gccgtttttg acatcgagaa gagaaccgtg      1080
     aacgtttga                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page