(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE321

CAGLA1_12.PE321      Location/Qualifiers
FT   CDS_pept        complement(743020..743961)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438995"
FT                   /gene_name="LGE1"
FT                   /locus_tag="CAGL0M07337g"
FT                   /product="Transcriptional regulatory protein LGE1 "
FT                   /biological_process="chromatin modification"
FT                   /biological_process="regulation of transcription "
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62643.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0016568"
FT                   /db_xref="GO:0045449"
FT                   /db_xref="HOGENOM:HBG124087"
FT                   /db_xref="InterPro:IPR021581"
FT                   /db_xref="UniParc:UPI00003B7119"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJC7"
FT                   /transl_table=1
FT                   /translation="MSDERYQSRYGRYDSGRGGRSGYYSNYQNSSHHRSNDGPNTNTHG
FT                   PSNGNGNSGGYYHGYYNRHGSMNGRAASSGRGYYGGHNTHITSAPHNNPNAYSRAPATG
FT                   NTSYTGSYYSRGGNSSGRGGYSSYNRGGYHASHQYNNGGYYHRNNNYNSSYTERQKSVS
FT                   GDSATSGGMKYTSSHRTTHVTHPAHPPITIQRSGSNGNGVAQGNASSGEVPTAPRRETT
FT                   AQNNGRDKREEQLKKYGISNMAQGYLEIMDQNSSSTTSVTQTEIELDEKLREMNSQVFR
FT                   TMCELALVENQYTRDTLNVQLTQEKLDTLLLS"
     atgagtgacg aaaggtatca gagcaggtac ggtaggtacg atagtggtag aggtggtaga        60
     agcgggtatt actctaatta ccagaattct agccaccaca gatcaaacga cgggcccaat       120
     acaaatacgc atgggcccag caacggtaat ggtaacagtg gtggctatta ccacgggtat       180
     tacaataggc acggctcaat gaacggtagg gctgcaagtt caggcagagg gtactatggt       240
     ggacacaata cacatattac tagtgcacca cacaataatc ctaatgcata ttcgagggcc       300
     ccagcgacag gcaacacgag ttatacaggc tcatattatt ctcgaggtgg gaattcaagt       360
     ggacgtgggg gctactcttc atataaccgc ggcggatacc acgcttcaca ccagtataat       420
     aacggtggct actatcatcg caacaacaac tataatagca gctacacgga gagacagaag       480
     agtgtcagcg gtgatagtgc cactagtggt ggcatgaagt atacatcatc acatcgtacc       540
     actcacgtga cacacccagc acacccacca ataacaatac aacgtagtgg tagtaacggc       600
     aatggagtag cccaaggcaa tgccagctca ggagaagtac cgacagctcc cagaagagag       660
     actacagctc agaataatgg cagggacaaa agagaagagc aactaaagaa atatggtata       720
     agtaacatgg cccaaggcta tctggagatc atggatcaga atagtagcag taccacaagc       780
     gttacacaaa ctgagataga gttagatgaa aaattacgtg agatgaacag ccaagtgttt       840
     cggacaatgt gtgaactggc cttagtagag aatcaataca cacgcgacac tttgaatgtc       900
     caacttacgc aggagaagct agacacatta ttactcagct aa                          942
//

If you have problems or comments...

PBIL Back to PBIL home page