(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE323

CAGLA1_12.PE323      Location/Qualifiers
FT   CDS_pept        complement(745077..746510)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349256"
FT                   /locus_tag="CAGL0M07381g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="glycolipid 2-alpha-mannosyltransferase activity "
FT                   /biological_process="protein glycosylation"
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62645.1"
FT                   /db_xref="GO:0004377"
FT                   /db_xref="GO:0006486"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="HOGENOM:HBG124090"
FT                   /db_xref="InterPro:IPR002685"
FT                   /db_xref="UniParc:UPI00003B711B"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJC5"
FT                   /transl_table=1
FT                   /translation="METRGLIHWLRYYYKVFHRNRTLKAVAVLLSFVLFIYYVRNSDIT
FT                   DKLVTFAGEENVKSLHAVKANIRANWNQEDDGDKFKKDLSASLQVKLDNILGTQNMSLA
FT                   EMGELPIDAETIEEQKSIRYAKLLKDHKATENSTMGFLFKSLANEGLKPSACIYSFVTG
FT                   NSELRKLLRTIESVQKKFNHKFGYPWVIISPEPLSEKFHADVEKKLEEFTSAIDDVKTE
FT                   VEFGTVPPEHWGFPDFIDSTVASNARIDLFDIPNGDSQLFRLINRYNAGLAAHHTLLKK
FT                   YDWYMRVSPGIRLNCEMEYDIMRWMQDNRKIFGFTLSIKEIERSAKKIWGHNLNFTAHN
FT                   REFYNPIEKSSLRSYIQVGRDTYNYCSFSTDLQIVNLNFLRSPVYTKYFEYMDKAGGIF
FT                   YERWSDSIIQSMAYSTMVPAKMIQHISPMGYQNKETVVCPADDIMWREYKCECDQGSDI
FT                   SFNRDLTCTQRYKDTQGMF"
     atggagacca gggggttgat acactggttg cggtactact acaaagtctt tcaccggaac        60
     aggactctga aagcggtcgc tgtgcttctg agctttgtgc tgttcatata ctacgtgcgt       120
     aactcagaca tcactgataa actggttacg tttgctggcg aggagaacgt caagagctta       180
     cacgctgtga aggcgaacat cagggcgaac tggaaccagg aggacgatgg ggacaagttc       240
     aagaaggacc taagtgcttc tttgcaagtg aagctcgaca acatactggg gactcaaaac       300
     atgtcccttg ccgagatggg cgagctgcca atcgatgcag agacgatcga ggagcagaag       360
     agtattcgtt acgccaagct gttgaaggat cacaaggcca cggagaacag cacaatgggg       420
     ttcctcttca agtctttggc taacgaaggg ctgaaaccct cagcatgcat atattctttt       480
     gtcacgggca actcagaatt gaggaagcta ctaagaacta tagagtctgt acagaagaag       540
     ttcaatcaca agttcggtta cccctgggtg atcatcagtc ccgagccctt gtcagagaag       600
     ttccatgccg acgttgaaaa gaaactagaa gagttcacat ctgctataga cgatgtcaag       660
     actgaggtgg agtttggaac cgtgccgcct gaacattggg ggttccctga ttttatcgac       720
     tcaaccgtgg cttcaaacgc cagaattgat ctgttcgata ttcccaacgg tgactcgcaa       780
     ttattcagat taatcaatag atacaacgct ggcctggcag ctcatcacac attgctgaaa       840
     aagtatgatt ggtacatgcg tgtgagcccc ggcatacggt tgaattgtga gatggaatac       900
     gacataatga ggtggatgca ggataaccgt aaaatatttg gattcacttt atcaatcaaa       960
     gaaattgaac gttctgcaaa gaaaatatgg ggccataact tgaatttcac tgcacacaac      1020
     cgagaattct acaaccccat tgaaaagtca agtttaagat cttacatcca agttggaaga      1080
     gatacataca attattgttc cttctctacc gatttgcaaa ttgtgaatct gaacttcttg      1140
     agatcaccag tatacacaaa atattttgag tacatggaca aagcaggagg catattctat      1200
     gagagatggt ccgatagcat tatccagtca atggcatatt caactatggt accagctaaa      1260
     atgattcaac atatcagccc aatgggatac cagaataaag agacagtagt gtgccctgca      1320
     gatgatataa tgtggaggga atataaatgt gaatgtgatc aaggtagtga tatttccttt      1380
     aaccgtgact taacttgcac gcagagatac aaagacactc aaggaatgtt ttga            1434
//

If you have problems or comments...

PBIL Back to PBIL home page