(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE325

CAGLA1_12.PE325      Location/Qualifiers
FT   CDS_pept        complement(748504..749631)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000176034" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438996"
FT                   /locus_tag="CAGL0M07425g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /biological_process="regulation of signal transduction "
FT                   /biological_process="response to biotic stimulus "
FT                   /protein_id="CAG62647.1"
FT                   /db_xref="GO:0009607"
FT                   /db_xref="GO:0009966"
FT                   /db_xref="HOGENOM:HBG270660"
FT                   /db_xref="HOGENOM:HBG324543"
FT                   /db_xref="InterPro:IPR007304"
FT                   /db_xref="UniParc:UPI00003B711D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJC3"
FT                   /transl_table=1
FT                   /translation="MSGTILEQFRGIQGTIDRKLLHTQLRQDSEEYQKLLTGTIQELLD
FT                   LKSKVYHKLSLFSSNETVEDIATSSLLYLSLDYYLGLLCSRKQATSNQLANPMDKNKMR
FT                   IMFLDKAIQLFMQYLSTLQDNEILDESISKKIDGFENTFMPTMDELYAVPKHKEDLSGA
FT                   QLRRQEKIEMHKQNTAVAQQLRILEGKVSEDQENDDDELLRKLYLQKLKLLSYETFDEI
FT                   EKILYEKELLSNFVRMAPQSDNEPHLAGNDQSKSSNDDPTGYTDKLETLNKPLLSKHGK
FT                   VLRNFTLVDKRSELKSKVKGYGQYGPTMSVEEFLEQEWEQGRVLQGGEEPTKEEIEALN
FT                   EDNMEWQDKETYKAREWDEFKEENPKGSGNTMNRG"
     atgtctggca ccattttaga gcagtttaga ggcatacaag gcaccataga tagaaaactt        60
     ctccatacac agctaagaca ggattcggaa gagtaccaaa agttgctgac cgggacaata       120
     caagagctcc ttgatttgaa gtccaaagtt taccataaat tatcattatt cagctccaat       180
     gaaactgttg aagacattgc tacgagctcg ttgctatacc tttccttaga ctattatctt       240
     gggctgctat gctcacgtaa gcaagcaaca tctaaccaat tagcaaaccc aatggacaaa       300
     aacaagatga ggataatgtt tttggacaaa gcaatccaat tatttatgca atatctgagc       360
     actttacagg acaatgaaat cctcgatgag agcattagta agaaaatcga cggttttgag       420
     aacaccttca tgccaaccat ggatgaatta tacgcggtgc caaagcacaa ggaagacttg       480
     tctggcgcac agttgagacg tcaggagaag attgaaatgc ataaacagaa cactgctgtt       540
     gctcagcagc ttagaatatt agaagggaaa gttagtgagg accaagaaaa cgatgacgac       600
     gagctcttac ggaagttata cctacaaaaa ctaaagcttt taagttacga aacctttgat       660
     gagatagaaa aaattcttta tgagaaggag cttctgtcaa actttgtcag gatggcacca       720
     cagagcgaca acgagccaca cttggcgggt aatgatcaaa gtaaaagcag caatgacgac       780
     cctactggat acaccgacaa gttagagaca ctgaacaaac cattattatc caagcatggt       840
     aaagtactgc gtaatttcac tctggtagat aagaggtctg agttaaaaag caaagttaag       900
     ggctatggtc aatatggtcc gaccatgtca gtggaagagt tcctagaaca agaatgggaa       960
     caaggtagag ttttgcaagg tggtgaagaa cccacgaagg aagagataga agctcttaac      1020
     gaggacaata tggagtggca agacaaggag acatacaagg caagagagtg ggacgagttc      1080
     aaggaggaga atcctaaagg tagcggtaac actatgaaca gaggttaa                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page