(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE326

CAGLA1_12.PE326      Location/Qualifiers
FT   CDS_pept        complement(749980..751392)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000172710" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438997"
FT                   /locus_tag="CAGL0M07447g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62648.1"
FT                   /db_xref="HOGENOM:HBG027398"
FT                   /db_xref="HOGENOM:HBG696796"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="UniParc:UPI00003B711E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJC2"
FT                   /transl_table=1
FT                   /translation="MSLPRRCMTSDKGTFGAYTAEERWPIIVQNAIDDVDAELKDIKDR
FT                   GDDSEQILEDGELLKKQLIEFREEILANTPLRKFTEQEIAIANIPLSFNETLDETADIN
FT                   KSWISSEWLFTEVYMYRRINVLFKSKKSPFWQEFDIFDRLKQSTFKASLHGVVELAIRY
FT                   KKLSHELQSLDLSSGESQEVLKILFKEFTEVSLWGNATDLSLLTSISLEDIKSIQGAKA
FT                   REASESKIVVNDTDKAWDALISSKPGNRRVDFVLDNSGFELYADFLMGAFLLRSKLASK
FT                   CIFHAKDMPYMVSDVMMKDFETLLKDLEDRDFFPVTSGSEDDLALNDLATDIRDFIKEG
FT                   SFEFRTDSFWTTELDYWNIDPSEKKYHGAEIHNDFTKSNLVIFKGDLNYRKLTGDRTWP
FT                   RTTSWEAAIGPLAHNGVPTLSLRTCKATVQVALPEGKDEELSAVWEKDHPGQGSWWCCS
FT                   GKWAVICFSDGK"
     atgtcattgc caagaagatg tatgacctct gacaaaggta cctttggtgc ctatactgca        60
     gaggaacgtt ggccaattat tgttcaaaac gccatagatg atgttgacgc tgagttgaaa       120
     gatatcaagg atcgtggtga tgattctgag cagattttag aagacggtga gttgcttaag       180
     aaacaattga ttgagttccg tgaggaaatt ttggcaaaca cgccattgcg taaatttacc       240
     gagcaagaga ttgccattgc aaacattcct ttgtctttca acgaaacgtt ggatgaaact       300
     gctgatatta acaagtcctg gatatcatct gagtggctat tcaccgaagt ttacatgtac       360
     agacgcatta acgttttatt caagtccaag aagagcccat tctggcagga attcgatatc       420
     tttgacagat tgaaacagtc tactttcaag gcttcccttc atggtgtagt agaactagct       480
     atcagataca aaaagttaag ccatgaattg caatccttag atctttcttc tggggaatct       540
     caagaagttc tgaagattct ttttaaggaa ttcaccgaag tttctctatg gggtaatgcc       600
     acagatcttt ctttgttgac aagcatctct ctagaggaca tcaaatctat tcaaggagcc       660
     aaggctagag aagcctccga aagtaaaatt gtggttaatg ataccgacaa agcttgggat       720
     gcattgattt cgtccaagcc aggcaacaga agagttgatt ttgtgctaga taactctggc       780
     ttcgagctat atgctgactt cttaatggga gctttccttc tgagatcaaa gttggcctca       840
     aagtgtattt tccatgctaa ggatatgcca tacatggtaa gtgacgtaat gatgaaagac       900
     tttgaaactt tactgaagga tctggaagat cgtgactttt tcccagttac cagcggttca       960
     gaggatgact tggctctaaa tgacttggct actgatatca gagatttcat caaagagggc      1020
     tcatttgaat tccgtactga cagcttttgg actaccgaac tagattactg gaatattgac      1080
     ccatctgaga aaaagtacca cggcgctgaa atacataacg acttcactaa atccaacttg      1140
     gtgatcttca aaggtgattt gaattacaga aagttaaccg gtgataggac atggccacgc      1200
     acaacatcgt gggaagccgc aattggccct ctagcacata acggtgttcc aactttaagt      1260
     ctgagaactt gtaaggctac tgtccaagtt gcgctgccag aaggcaagga cgaagagcta      1320
     tctgcagtat gggaaaaaga tcacccaggg caaggttctt ggtggtgttg tagcggtaaa      1380
     tgggctgtca tctgtttctc agacggaaag taa                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page