(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE327

CAGLA1_12.PE327      Location/Qualifiers
FT   CDS_pept        752098..753375
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000038427" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17438998"
FT                   /locus_tag="CAGL0M07469g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="zinc ion binding"
FT                   /biological_process="peroxisome organization"
FT                   /cellular_component="peroxisomal membrane"
FT                   /protein_id="CAG62649.1"
FT                   /db_xref="GO:0005778"
FT                   /db_xref="GO:0007031"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="HOGENOM:HBG189863"
FT                   /db_xref="HOGENOM:HBG203384"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniParc:UPI00003B711F"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJC1"
FT                   /transl_table=1
FT                   /translation="MSFFSNLPATATSNSGEGVSSLFPTIFEIVSSQEIDELLPASIRY
FT                   ILTNYWISRYPSWTTLQVNNYFEEWFGVGVQGLVEWYHIDKYNSTFVDKFYGLQRFNNS
FT                   DPVLTQAQAIRQAREAGNPNLQWPKSLQLTNGQKRVVFLQKIILPYISHRLSEVYNKLK
FT                   SRIAMLSTELDDETGGADKKTKLKRFVIKWFVRLYPLWNSLTSLLNMVVKLAFLTGRTG
FT                   SMTFLEYLFKIEYTRMTLPLENGSISPSKTLKNNERPTRTNMSSIRGIFESAIGSLGGM
FT                   AGLTGSQLFPAFIFMLRVYQWWNTEDLTTKLQKKLNDIDKDIPRPPNAHISEEASNDSF
FT                   EDSEMSQISEKIGTKKSDICPICKDSIENPCVLETGYVTCYACALDYIPKHEGRCPVTG
FT                   KRLLGCQFDSESGEWKVVTGIRRLLV"
     atgagtttct tctctaatct gccggcaacg gctacctcta acagtgggga gggagtatcc        60
     tcgttattcc cgactatatt tgaaatagtt tcctcacaag agatagatga gctcttgcca       120
     gcatcaatac gttacatact cacgaattac tggatctcca gataccccag ttggacaaca       180
     ttgcaagtga ataactactt tgaagaatgg tttggcgtcg gagtacaagg tcttgttgaa       240
     tggtaccata tcgacaagta taactccaca tttgtagaca aattttatgg tttgcaacgg       300
     tttaacaata gtgacccagt attaacgcag gcacaagcta taaggcaggc acgagaggca       360
     ggtaacccaa atttacaatg gcctaaatcc ttacagctga ctaatggaca gaaaagagtg       420
     gtgtttttac agaagataat tttaccatat atcagtcaca gactttctga agtctataat       480
     aaactaaagt ctagaattgc catgttatcc accgagttag atgatgagac tggtggggca       540
     gataaaaaga ccaagttaaa gagatttgtt ataaaatggt ttgtcagact ttaccctttg       600
     tggaacagct taacatcttt gttaaacatg gttgttaaat tagcattttt gaccggtaga       660
     actggttcta tgactttctt agaatactta ttcaagatag aatatacaag aatgacacta       720
     ccactggaga atggtagtat ttcaccttct aaaacgctca aaaataatga aaggccaact       780
     agaacaaata tgtcctctat cagaggcatt tttgagtccg ctattggttc attaggaggt       840
     atggcgggac ttacaggttc tcagttattc cctgcattca tatttatgtt acgagtttac       900
     caatggtgga acactgaaga ccttacgaca aaattacaga aaaaacttaa cgacatagat       960
     aaagacatac caagaccacc aaacgcgcac atatcagaag aagcatctaa tgatagtttt      1020
     gaagactctg aaatgagtca gatctctgaa aaaataggca ctaaaaagag tgatatttgt      1080
     ccaatatgta aagactccat cgagaatcct tgtgtccttg agactggtta cgttacgtgt      1140
     tatgcatgtg cattagatta tatccccaaa catgaaggtc gctgccctgt gactggtaag      1200
     cgtcttcttg ggtgccaatt tgattctgaa agtggagaat ggaaagttgt tacaggtatc      1260
     agaagacttc tagtataa                                                    1278
//

If you have problems or comments...

PBIL Back to PBIL home page