(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE330

CAGLA1_12.PE330      Location/Qualifiers
FT   CDS_pept        756457..757920
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000200714" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439000"
FT                   /locus_tag="CAGL0M07546g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /biological_process="tRNA modification"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62652.1"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0006400"
FT                   /db_xref="HOGENOM:HBG001389"
FT                   /db_xref="HOGENOM:HBG746795"
FT                   /db_xref="InterPro:IPR002917"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="UniParc:UPI00003B7122"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJB8"
FT                   /transl_table=1
FT                   /translation="MVGIRFLSHTRQRLPTIYSMVTPRAKSAVSVIRVSGDKAQYVYRK
FT                   LTRRDDVPRSRQACLRGLYNGDNELIDRALVLYFKSPGSFTGEDVVEFQVHGGRAVSES
FT                   VLSAIGSLNNRDQDVEIRMADRGEFSRRSFLNGKADLTGLEGINTLINADTEAQRRAAM
FT                   GSFTGKNKALFNRWRDIAIQNSAQLTAIIDFSEDSDFADEYTAVMAEVRQELMGLRTEI
FT                   GNFIARVTKASIVENGINMTLLGAPNVGKSSLLNQIASDDISIVSDIPGTTRDIVSSIV
FT                   NINGYKVNLFDTAGIRVDTTDPIEKMGIEKAFKRIGSSDICICVIDGTQPLPLNVLDLL
FT                   KSSDLSGSEIIFVVNKIDIVDDSCKLSKIQQYIGNNLTGCKICFVSCLKSTGIDELVTV
FT                   LTGKFKTLTQNEENEDPIIVSDRVKEILEKDVLYGIDQFLQIQDDMHDIVIATEHLRYV
FT                   IDGIGKITGEVIGLEEVLDVVFSKFCVGK"
     atggtcggta tcaggttttt gtcacacaca aggcaacggt tgccaacaat atactcgatg        60
     gtgacaccgc gcgccaaatc ggccgtctct gtgatcaggg tctctggaga caaggcacag       120
     tatgtgtata ggaaacttac gagacgtgac gacgtgccgc gaagcaggca ggcctgtttg       180
     cgtgggttgt acaacgggga caacgagctg atagaccggg cgttggtgct atacttcaag       240
     tcgccgggtt ctttcactgg ggaagatgtg gttgagtttc aagtgcatgg tgggagagcg       300
     gtctcagaga gtgtgttaag tgccattggg tcattgaata atagagatca ggacgtggaa       360
     atacggatgg ctgatagagg tgagttctct cgcagatcgt tcctcaatgg caaagcagat       420
     ctgactggct tggaaggtat caacacattg attaatgccg atacggaggc gcaacgcaga       480
     gctgccatgg gctccttcac aggtaagaat aaagcattgt ttaaccgctg gcgggatata       540
     gccattcaaa actcagccca actcactgcc atcattgact tctccgaaga ttctgatttt       600
     gctgatgagt atacagctgt tatggcggag gtccggcaag agttgatggg gctaagaacc       660
     gagataggca attttattgc cagagtcact aaggcatcaa ttgtggaaaa tggtattaat       720
     atgacattgc tcggcgcacc taatgtgggg aagtcgtctc tgctgaacca aatagcaagc       780
     gatgatatct ctattgtgag tgatatacca ggtactacga gagacatagt atcttcaatt       840
     gtaaatatta acggatacaa ggtcaatcta tttgacactg cgggcatacg agtggacaca       900
     acagatccaa tcgagaaaat gggcatagaa aaggcattca aaagaattgg ttctagcgat       960
     atttgcatct gtgttataga cgggacccaa cctctaccct taaatgtatt agatctgctc      1020
     aaatcgagcg atttgtcggg gtcagagata atatttgttg ttaacaagat agatattgtg      1080
     gatgatagtt gcaaacttag taagatacaa caatatattg gtaacaatct gactggttgc      1140
     aagatttgtt ttgtatcttg tttgaaatcc accgggatag atgaactagt gactgtactt      1200
     acgggaaagt tcaaaacttt gactcagaat gaagagaatg aggatcctat catagtttct      1260
     gatagagtga aagaaatact cgagaaagat gtgttatatg gcatcgatca gttcctacaa      1320
     atacaggatg atatgcacga tatagtgata gcaactgagc atttgagata tgttatagac      1380
     ggtatcggca agataaccgg tgaagtaata ggactcgaag aagtgcttga cgtcgtattt      1440
     tctaagttct gtgtcggaaa atga                                             1464
//

If you have problems or comments...

PBIL Back to PBIL home page