(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE331

CAGLA1_12.PE331      Location/Qualifiers
FT   CDS_pept        complement(758110..758607)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000233454" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439001"
FT                   /locus_tag="CAGL0M07568g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="small conjugating protein ligase activity "
FT                   /biological_process="post-translational protein
FT                   modification"
FT                   /biological_process="regulation of protein metabolic
FT                   process"
FT                   /protein_id="CAG62653.1"
FT                   /db_xref="GO:0019787"
FT                   /db_xref="GO:0043687"
FT                   /db_xref="GO:0051246"
FT                   /db_xref="HOGENOM:HBG492183"
FT                   /db_xref="HOGENOM:HBG756483"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="UniParc:UPI00003B7123"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJB7"
FT                   /transl_table=1
FT                   /translation="MSKTAQKRLYKELQQLIKDSPPGIVAGPKSDDNLFVWDCLIQGPP
FT                   DTPYAGGVFNAQLEFPKDYPLSPPKLTFTPSILHPNIYPNGEVCISILHSPGDDPNMYE
FT                   SAEERWSPVQSVEKILLSVMSMLSEPNIESGANIDACILWRDNRAEFEKQVKLSILKSL
FT                   GF"
     atgtcaaaga ctgctcagaa gagactttac aaggagttac aacagttgat caaggactct        60
     ccaccgggga tagtcgcagg acccaagtcc gacgacaatc tgtttgtgtg ggactgtttg       120
     atacagggcc ctccagatac accttatgct ggcggtgtat tcaatgcgca gttggagttt       180
     cctaaggact acccgctatc tccaccgaag ttgaccttca cgcctagtat tctacaccct       240
     aatatctacc cgaatggtga agtgtgcata tcgatcctgc actccccagg tgatgatccc       300
     aatatgtatg agtctgcaga ggagagatgg tctccagtgc agagtgtgga aaagatcctg       360
     ttgagcgtga tgagtatgct gagtgaacct aacattgaga gtggtgccaa tattgatgcc       420
     tgcattttgt ggagggataa cagagcagag ttcgaaaaac aagtcaagtt gtctatactc       480
     aaatcactgg gtttctaa                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page