(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE332

CAGLA1_12.PE332      Location/Qualifiers
FT   CDS_pept        758940..760310
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000066040" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439002"
FT                   /locus_tag="CAGL0M07590g"
FT                   /product="Similar to uniprot|P35192 Saccharomyces
FT                   cerevisiae YMR021c metal binding activator "
FT                   /function="DNA binding"
FT                   /function="copper ion binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAG62654.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005507"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG124093"
FT                   /db_xref="HOGENOM:HBG203382"
FT                   /db_xref="InterPro:IPR001083"
FT                   /db_xref="UniParc:UPI00003B7124"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJB6"
FT                   /transl_table=1
FT                   /translation="MIIFKNDKYACVKCIRGHRSSLCVHTGRMLVKVRNRGRKKGIDVR
FT                   DAIVVGDIHRKRSCECASGHAGDDSKQYGAPNADVSRPHESGLNSTCVGMNKQPILFVR
FT                   AKKVLKAQLIGGELKEMSEVDMSRLEVDTSDDETVATTTTVPKVEILDNNVLNVTQGNI
FT                   DDDMVLVDDTKNFAGASIGELIDEQLSSINVEPTGSHCCGSQPHGIDPMKTTTVTAAAT
FT                   ETEKYPFFQLLTKRGVYLSTQCSCSAANCACSNCLIHRTEEEINNYIEASGVPLTNLDS
FT                   STSLQATPEIESPRPSCMCKPEECTCDGCDIHTIEVVPFQRIVIHGLINTRLTKKTLIQ
FT                   YRKKLIGQKYWWDYCMVYIPCLRCNNFDGLDIVGFFDNIIKEHGHELEDAKEKVDAGSI
FT                   QNLTSQAENFIMNMNNSIDNGVSSNTTNNMNNINDTRLQSHYANLVKTEGTISPMFM"
     atgatcatat tcaagaacga taagtatgcg tgcgtgaagt gcatacgtgg acacaggtcc        60
     tcgctgtgtg tacacacagg caggatgctt gttaaagtga ggaaccgtgg tcggaagaaa       120
     ggtattgatg ttagagatgc gatagttgtt ggggatattc atcgtaagag gagttgtgag       180
     tgtgctagtg ggcatgctgg cgatgatagc aagcagtatg gtgctcctaa tgcggatgtt       240
     agtcgcccac atgagtcagg tttgaatagt acatgtgttg gtatgaataa gcagccgatt       300
     ttatttgtta gagctaagaa agtcttgaag gcacaactta tcggaggtga gttgaaggag       360
     atgagtgagg ttgatatgtc tcgattagag gttgatactt ccgatgacga gactgtagcc       420
     actaccacca cagtaccaaa agtagaaata ttagataata atgtacttaa tgtcacgcaa       480
     ggtaatatcg atgatgatat ggttctggtt gatgatacaa agaattttgc aggggcatcc       540
     atcggtgagc taatagatga gcaattgagt tcgataaacg tagagcctac gggctcgcat       600
     tgctgtggtt cacaaccaca cggtatcgat cccatgaaga ctacgacggt gactgcagca       660
     gcaacagaga cagaaaagta tccattcttc cagttgctca ctaagcgtgg tgtctatctg       720
     agcacacaat gttcttgctc cgcagctaac tgtgcatgca gcaactgtct gatacatagg       780
     actgaagaag agatcaataa ttatattgag gctagtgggg taccgttgac caatttagat       840
     agctccacga gtcttcaagc tacgccggag atagagagcc ctagaccttc atgcatgtgc       900
     aaacctgaag agtgtacgtg tgatggttgt gatatacata cgatagaagt tgtaccgttc       960
     cagaggatag ttatacatgg tttaataaac acaagactca caaagaaaac tctaatacaa      1020
     tataggaaga agttgatagg tcagaagtat tggtgggatt attgtatggt gtatataccg      1080
     tgtctacggt gtaacaattt tgatgggtta gatatcgttg gattttttga taatattatt      1140
     aaggagcatg gtcatgagct tgaagatgcg aaggaaaaag tggatgcagg ttcaatacag      1200
     aacttgacta gtcaagctga gaattttata atgaatatga acaacagcat tgacaatggt      1260
     gtatctagca ataccacgaa caatatgaac aacattaatg atacacgatt acaatcacac      1320
     tatgcaaatc tagttaagac ggagggaaca atttctccga tgttcatgta g               1371
//

If you have problems or comments...

PBIL Back to PBIL home page