(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE333

CAGLA1_12.PE333      Location/Qualifiers
FT   CDS_pept        complement(760610..762355)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000246632" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044874"
FT                   /locus_tag="CAGL0M07612g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62655.1"
FT                   /db_xref="HOGENOM:HBG058190"
FT                   /db_xref="HOGENOM:HBG398221"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="UniParc:UPI00003B7125"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJB5"
FT                   /transl_table=1
FT                   /translation="MDRTYDVVVVGAGIAGLKAASVLTQSGKSCLVIESRDRIGGRLCT
FT                   VTGYNGARYDLGASWHHDTLTNRLFAEEVQLAAVDGADSTPQMFSGGATHCSASSASSA
FT                   SSASTGGNSAGVYAPFVFDDDDPLIVDKIRGSLGDVTIRLIADEIEKFIELYFHSEYTA
FT                   ELSDDNDSQHSHEGFPRADMPLFDMLLMYLQQRAPFLTDDQMWYGIQYARYMELWHGVS
FT                   WYQLSSRDSFFGHQGRNAFVMNYDTIYNRIHGQIRTELGTVQLNSTVTKIENAGAHTTV
FT                   SYTTSSASGAEDTQHGQHGAAGQQHTVQCSYVIVTIPQSLLSEGAVEFKPPLVPQISAA
FT                   LQKMHFGSLGKVVFEFEECCWDLHTAKIVAVAHAAADTRAEFTALLRKESREKNYTAQR
FT                   LQALVQDVKQLLGDDAVRHDCWNQPLLFVNMAKTTGVPSLMMLMAPPLTHYIESLHDSH
FT                   QVYEFFKPVLSQIMSVCNAPGHIINGLDIAGGVAGDDANVSDKGPILRNVIVTDWTNDP
FT                   YSKGAYSACYAGDDALDMFLAMSNGQSSRVRFAGEHTILDGAGCAYGAWESGEREANYI
FT                   LKQMK"
     atggatagga catatgacgt ggtggtggta ggtgctggta ttgccggttt gaaagcagct        60
     tcagtgctga cacagagtgg taagagttgc ctggtaattg agtcacggga ccgtattgga       120
     ggcagactct gtaccgttac tgggtacaac ggcgcccggt atgatctggg cgcgtcctgg       180
     caccacgaca cgctcacgaa ccgtctcttt gcggaggaag tgcagctagc cgctgtggac       240
     ggtgccgaca gtactccgca gatgtttagc ggtggagcaa ctcactgctc tgcaagctct       300
     gcaagctctg caagctctgc aagcaccgga ggcaacagtg caggtgtgta tgcaccattt       360
     gtgttcgacg atgacgatcc gttgattgtg gacaagatcc gcggatccct tggcgacgta       420
     acgataagac taattgcgga cgaaatagag aagttcatcg aactgtactt ccactctgag       480
     tacactgcag agctcagtga cgataatgac tcacaacact cccacgaggg gttcccgcgg       540
     gcggatatgc cgctgttcga catgctactc atgtacctgc agcaacgtgc gccatttctc       600
     accgacgacc agatgtggta cggcatacag tatgcgcgtt acatggagct gtggcacggc       660
     gtgtcctggt accaactgag cagccgcgac agtttcttcg gccaccaagg ccggaatgca       720
     tttgtcatga actatgacac catatacaac agaatacacg ggcagatccg cacggagctt       780
     ggcacagtgc aattaaactc aactgtaacc aagatcgaga atgcaggagc acacaccaca       840
     gtatcttaca ccacttccag cgccagcggc gcagaagaca cacaacacgg ccaacacgga       900
     gctgcaggac agcagcacac cgtgcagtgc agttacgtga tagtaacaat tccccagagt       960
     cttctgagcg aaggagcagt ggagtttaag ccgccgctgg tgcctcagat ctctgccgct      1020
     ttgcagaaga tgcacttcgg ctccttgggg aaagtagtgt tcgagttcga ggagtgctgc      1080
     tgggatctgc acactgcgaa gatcgttgcc gtggcacacg cagcagccga cacccgggcc      1140
     gaatttaccg cattgctcag aaaggagagc agagagaaga actacacggc tcagcggttg      1200
     caggctctcg tgcaggatgt taagcagctt ttgggtgatg atgccgtcag gcacgactgc      1260
     tggaaccagc cgctgctgtt tgtgaacatg gccaagacca ccggcgttcc atccttgatg      1320
     atgttgatgg caccaccgct gactcactat atcgagtctc tgcatgactc tcaccaagta      1380
     tacgagttct tcaaaccggt gttgtcacag attatgagtg tatgtaacgc acctggtcat      1440
     ataatcaatg gtcttgatat cgctggtggt gtcgctggtg atgacgccaa cgtttcggac      1500
     aagggtccta tcctacgtaa cgtgatagtc acggactgga ccaatgatcc gtactctaaa      1560
     ggtgcttatt ctgcttgtta tgcaggtgat gacgccctag acatgttttt ggccatgagt      1620
     aatggacaaa gctctcgggt gaggttcgct ggtgagcaca cgattctaga tggtgctggg      1680
     tgtgcctatg gtgcttggga aagtggtgaa agagaagcaa actacattct aaagcaaatg      1740
     aaatga                                                                 1746
//

If you have problems or comments...

PBIL Back to PBIL home page