(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE334

CAGLA1_12.PE334      Location/Qualifiers
FT   CDS_pept        763929..764702
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439003"
FT                   /locus_tag="CAGL0M07634g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /protein_id="CAG62656.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="HOGENOM:HBG124094"
FT                   /db_xref="InterPro:IPR003163"
FT                   /db_xref="InterPro:IPR018004"
FT                   /db_xref="UniParc:UPI00003B7126"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJB4"
FT                   /transl_table=1
FT                   /translation="MSERELPGYTYLPPPRLSYQPSIALVPGVMQVRPPASPASPVGTG
FT                   AGTPGAAGTTGITGISSTTGTTGTGGTALGTVPTSALTNNNNNNNSSSSGNAYMTSALA
FT                   SWNQYQYPWLQHPLLSRVITTYWEDEHTICHGVNHNGVTVVRRADNDMVNGTKLLNVTG
FT                   MTRGRRDGILKNEPVRDVVKGGPMTLKGVWIPIDRARAIARQEGIEQWLYPLFIDDLHQ
FT                   AITLLRQQVQPQVQMPAPQLPVQSQQLIPQIHHHM"
     atgtctgaaa gagaattgcc tggatacaca tacttacccc caccaaggct gtcataccag        60
     ccttctatag ctctagtacc tggagtcatg caggtgcgtc ctcctgctag tcctgccagt       120
     cccgttggta ctggtgctgg cactccaggt gctgctggta ctactggtat tactggtatt       180
     tctagtacta ctggtactac tggtactggc ggtactgcgc tcggtaccgt gcccactagt       240
     gcacttacca ataacaacaa caacaacaac agcagcagca gcggcaatgc gtacatgacg       300
     tctgcacttg cgtcctggaa ccagtaccag tacccgtggt tgcaacaccc gctgctgagc       360
     cgcgtgataa ccacgtactg ggaggacgag cacacgatat gccacggagt gaaccacaac       420
     ggagttactg ttgtgaggcg tgcggacaac gacatggtca acggcacgaa gctgctgaat       480
     gtcactggga tgacccgtgg cagacgggat ggtattctta agaatgagcc tgtgcgtgat       540
     gtagtgaagg gcggtcctat gacgctgaag ggtgtgtgga taccaataga ccgggcccgc       600
     gccatcgcga gacaggaagg catagagcaa tggctgtacc cattgttcat cgacgacctg       660
     caccaggcca tcacgttgtt gagacagcag gtgcagcccc aggtccaaat gcccgcccca       720
     cagctgcccg tccagtcaca acaactcatc ccccaaatac atcaccacat gtaa             774
//

If you have problems or comments...

PBIL Back to PBIL home page