(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE337

CAGLA1_12.PE337      Location/Qualifiers
FT   CDS_pept        772364..773746
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000141906" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501424"
FT                   /locus_tag="CAGL0M07700g"
FT                   /product="Similar to uniprot|P20048 Saccharomyces
FT                   cerevisiae YMR013c dolichol kinase "
FT                   /function="kinase activity"
FT                   /protein_id="CAG62659.2"
FT                   /db_xref="GO:0016301"
FT                   /db_xref="HOGENOM:HBG398767"
FT                   /db_xref="HOGENOM:HBG429566"
FT                   /db_xref="UniParc:UPI00017BD8F3"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJB1"
FT                   /transl_table=1
FT                   /translation="MEVIPQLWQLVMLSVPFMYCYDNVMELLCSSVVVQMVIVVHLVCF
FT                   VLRRKLFDDFYRIYLPFLVSFTFCDRTLTELNMIMSTTAVIPSNYTPIHLVGLIFQAGL
FT                   MKIGMHNYDYISGVKCLVANYLLVNWLEDIGQLKTLDQIDCNLFGILLTDCLMINNATA
FT                   PNYLLVLKGAMTSVMIIIVVNHFLTRLIPSLSNSIVLAGNFLVLFPILVNHLIDFSNEK
FT                   ITSPALWLIDFILESEIRQYIMLSWVIVLVVFIPLVILFKSKISLNTSRKIWHFVIFLL
FT                   IVEPFHLDPEFVKISLCGIIPCFLSVEYLRYLKIEPYGEHLDFFLRSFADYRDQRGPLI
FT                   VSYIYLITGITIPLLLFESPVGLVSLGVGDSLASIVGKKVGRMHWKGTNKTIEGTVAFI
FT                   VGTTFISWILQRYFNYFSTIDIFKILVICTTGGVLEGNSELNDNILIPLFMVSMEKLLA
FT                   QS"
     atggaggtta tcccgcaatt atggcagctt gtgatgcttt cggttccatt tatgtactgc        60
     tatgataatg tcatggagtt attatgcagt tcggttgtgg tgcaaatggt aatagtggtt       120
     cacttagtat gctttgtgct ccggaggaag ctgtttgatg atttctaccg tatatacttg       180
     ccattcttgg tgtccttcac gttctgtgat agaactttaa ctgaactgaa tatgattatg       240
     tctacaacag cagttattcc ttcgaattat accccaattc atttagtggg acttattttc       300
     caagctggtc tgatgaaaat aggtatgcat aactatgatt atattagcgg agttaaatgc       360
     cttgttgcca attatctgct tgtgaattgg ttggaagata ttggtcaatt gaaaactttg       420
     gaccaaattg attgtaatct atttggtatt ctcttaacag actgtctgat gatcaataat       480
     gcaacagcac ccaattatct attggtgcta aaaggagcaa tgacgagtgt tatgataatt       540
     attgtagtga atcacttttt gacacgatta atacctagct tatccaacag cattgtgtta       600
     gccggtaatt ttttggtact tttcccaatt ttggttaatc atttgattga tttctccaat       660
     gagaaaatta cttcgccagc gttgtggcta attgatttta ttctggagtc agaaataaga       720
     cagtatatta tgctttcttg ggtaatagta ctggttgtat ttattccctt ggttatacta       780
     ttcaagtcaa agatatcctt gaatacttca agaaagatct ggcattttgt tatttttctc       840
     ttaattgtgg aaccatttca cctagatcca gagtttgtta aaatttcact ttgtggtatc       900
     attccatgtt ttctgagtgt agagtacctt cgatacctga aaatagaacc atatggtgag       960
     cacctggatt tttttttgag atcatttgct gattacagag atcaacgagg tcctttaatt      1020
     gtatcttaca tatatctgat tactggaata acaatccccc tgttgctgtt tgaatctccg      1080
     gtaggattgg taagtttagg tgtgggtgac tcattagctt ccattgtagg caaaaaggta      1140
     ggccgcatgc attggaaggg gactaataaa acgatagagg gtacagtggc cttcatcgta      1200
     ggcacaactt tcataagttg gatacttcaa agatatttta attacttcag cacaattgat      1260
     atatttaaaa ttcttgttat atgcaccaca ggaggtgttt tggaggggaa tagtgaactt      1320
     aatgacaaca tattgatacc gctttttatg gtatcaatgg aaaaacttct ggcacagtca      1380
     tga                                                                    1383
//

If you have problems or comments...

PBIL Back to PBIL home page