(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE338

CAGLA1_12.PE338      Location/Qualifiers
FT   CDS_pept        complement(774048..777851)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000154574" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439005"
FT                   /gene_name="TIF31"
FT                   /locus_tag="CAGL0M07722g"
FT                   /product="Protein TIF31 homolog "
FT                   /function="binding"
FT                   /protein_id="CAG62660.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG058185"
FT                   /db_xref="HOGENOM:HBG203377"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI00003B712A"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJB0"
FT                   /transl_table=1
FT                   /translation="MSQPSDIVKVIVALPTLSKKPQQGKKKKSKELEEITLQFRKDSKL
FT                   QNVLDFLSIAPATKYFTNYNLKNSTGDLLLSSEEKTLRELCSDKDEYKVALELKPYNQY
FT                   QALKHVLTSRDFFGFASETEDGLSNVAVSTGSKFYKLPLKEIKEKSPENEDKDTENKKP
FT                   TSMNVTDEEKVEFNHMVHGLFETLKKEKKVLLKDLMNTDTSVVTPCLRSINFSPYNPVP
FT                   AFYRTKGHLFYLQIVTLEGESLQVTAIPSGFYINKSTTSKFDPSPKENDGHVDTVHYTL
FT                   YDLLASSSKNFVTHISSLEKKFDDLESVTYVRPACTTLNKPWLIPAIPTNGPDYLRTQI
FT                   DSFNFEPERNFNDEFQSIKEIPTNTLQARIESERIFAKLTHEFTINATKGAMDILYGNG
FT                   TAMNPDSPLEEQIFLKNNIFYSFVGDLNQTYADKGGDEAAIASANQDLRTLNMLTRLNL
FT                   PNIHHLLTTIVDFGGKRILAQTPVPGLLSPMGVKITTNEETKEETVSELSSDICVKYGL
FT                   DENEKKVVFNEEFDEILNDQFAKSFHLKKHTIQGTELVFSSQSKGIVGSDKRHYILDLA
FT                   NTYPLDVEFAKENFDDVKEASKKYPHRQTLIRPELVEKWWATKIENDKVELVKAYEENL
FT                   YSYNPDAYQVPGVEDETVVEISKYLNEEIIPNVVQDYLNGNIISPYNGEHLADTFHKNG
FT                   VNMRYLGKFANLVKEELRKQEEAHEAKLAQVIVDNKEYEEWEKSYLQKIETMIKERQAK
FT                   INKLVQEGKEVPKELTEDLKLDDNEIKKPSTEKPVVVSYDELVPLIKTAELEIISRSLK
FT                   HILRKYSRSLPPIVIPALISFVFNLLFGTTYNPAPAVESVDPLYPVDQYEFKNLTHDTL
FT                   LKEIEQEAVVRYRYELEGDWFAEHELYPFTLIRSICNKFGVQLLNKDYFFSTEQLEEYK
FT                   QSLDKKSRAKYVAPLTTFSVSDLTVIPKIKAIDYSSPISEELWSQGASIINENQKDGLT
FT                   LLAQSIGFKEEVNSILHSSVAEKYLTLSTIYNKLGLNAEAIAFCRKSCAIYERVCGVDS
FT                   FELLRALTNLATLEFANESPYNVALIYQRIIQTVSGYGLDKIHHPIFTNIFNYLEQLSL
FT                   GVQDAKLAVEVLKSLGDFLVSIDGTESLPYAYIKSKLGNLLAADNRFSDALNQIKVAER
FT                   IFTKELGTNHGSTAQARQWVDGLTNLIKDVNQKKQLQQDQTAASGLKQQPQKSKSGHNK
FT                   KETTNPDLADKSVDELLSFIEGEDGKSSKTTKKSKSKGKNKK"
     atgtcacaac caagcgatat tgtgaaggtg attgtagcct taccaacact atccaagaaa        60
     ccccaacaag ggaaaaagaa gaaatccaag gaacttgaag aaattacttt acaatttaga       120
     aaggactcta agttgcaaaa tgttttagat tttctttcaa ttgctcctgc aactaagtat       180
     tttaccaatt ataacttgaa gaactcaact ggtgatttac tactaagctc tgaagagaaa       240
     actttaagag aactgtgcag cgataaagac gaatacaaag ttgctttaga attgaagcct       300
     tacaatcaat accaagcttt gaagcatgta ttaacatcta gagatttctt tgggtttgcc       360
     agcgaaactg aagatggttt atccaatgtt gctgtttcta ctgggtctaa gttctacaaa       420
     ttgccattga aagaaattaa ggagaagtct ccagaaaatg aagacaaaga tactgaaaac       480
     aaaaaaccca cttcaatgaa tgttactgat gaggaaaagg tcgaattcaa tcacatggtg       540
     catggtttat tcgaaacatt aaaaaaggag aagaaagttc tattaaaaga tctcatgaat       600
     acggacacta gtgttgtcac accatgtttg cgttctatca acttctcgcc atacaatcca       660
     gtaccagctt tttacagaac taaaggccac ctgttctact tgcaaattgt tactttagag       720
     ggtgaaagct tacaagtaac tgccattcca tccggtttct acatcaacaa gtcaaccacc       780
     agcaagtttg atccatctcc taaggaaaat gacggccatg ttgatactgt acattacact       840
     ttgtatgatt tattggcttc ttcatctaaa aattttgtta cacacatttc aagtcttgaa       900
     aagaagtttg atgatttgga atctgttact tacgtaagac cagcatgtac aactttgaac       960
     aaaccatggt tgattcctgc aatccctaca aatgggccag attatctacg tacgcaaata      1020
     gattctttca acttcgagcc ggaacgtaat ttcaacgatg aattccaatc tataaaggaa      1080
     atcccaacca atactctgca agctagaatt gaaagtgaaa gaatttttgc taagttgact      1140
     catgaattta caatcaatgc aacaaaaggt gctatggata ttttgtatgg aaatggtaca      1200
     gcaatgaacc ctgactcacc attggaagaa caaatcttcc taaagaacaa cattttttac      1260
     tcctttgttg gtgacctaaa tcaaacttat gctgataaag gtggtgatga agctgcaatt      1320
     gcttctgcta atcaagattt aagaacgttg aacatgttga cgagattgaa cttgccaaat      1380
     attcatcatc tattgaccac gattgttgac ttcggcggta agagaattct tgcgcaaact      1440
     cctgttccag gtctgctttc tccaatgggt gtgaaaatta caactaatga ggagaccaag      1500
     gaagagactg tatctgaact gtctagtgat atttgtgtga aatatggtct agatgagaac      1560
     gaaaagaaag ttgtatttaa tgaagaattt gacgaaatct taaatgatca gtttgccaag      1620
     tctttccatt tgaaaaaaca caccattcag ggtactgaat tagtgttttc cagtcaatct      1680
     aagggtattg ttggttctga taagagacat tacatcttag atttggctaa cacataccca      1740
     cttgatgttg aatttgccaa ggaaaacttt gatgatgtta aggaggcatc taagaaatat      1800
     ccacatcgtc aaactttgat tcgtccagag cttgttgaaa aatggtgggc aaccaagatc      1860
     gagaatgata aagttgaatt agtcaaggct tatgaagaga acttgtactc ttacaatcct      1920
     gacgcatacc aagttccagg tgtagaagat gaaactgtcg tggaaatttc aaaatatcta      1980
     aatgaagaga ttattccaaa cgttgttcaa gattacttga atgggaatat tatttctcct      2040
     tacaatggtg agcatctagc tgatactttc cacaaaaatg gtgtcaacat gcgttacctt      2100
     ggtaagttcg ccaatttggt caaagaggaa cttcgtaaac aagaggaagc tcatgaagct      2160
     aaactagctc aagttattgt tgacaataaa gaatatgaag aatgggaaaa atcatacttg      2220
     caaaagattg aaacaatgat aaaggaaagg caagctaaga tcaacaaatt agttcaagaa      2280
     ggcaaagaag ttccaaagga gcttaccgag gacttgaaac ttgatgacaa tgaaatcaaa      2340
     aagccttcta ctgaaaaacc agtggttgtg tcatatgatg aattagtgcc tcttatcaag      2400
     acagctgagc tggaaattat ttcacgttct ttgaaacata tcctaagaaa atacagcaga      2460
     agtctaccac ctattgttat tccagcttta atttcatttg tgtttaacct acttttcgga      2520
     actacataca atcctgcacc tgctgttgaa tcagtggatc cattataccc agttgatcaa      2580
     tacgaattca agaacttaac ccatgatact ctattgaaag aaattgaaca agaagctgtc      2640
     gttcgttacc gttatgaatt agaaggcgat tggtttgctg agcacgaact gtacccattt      2700
     actctaatta gatccatctg caataagttt ggggttcaac ttctgaacaa agattacttt      2760
     ttctcgactg agcaattgga agagtacaaa caatctttgg acaagaaatc cagagctaag      2820
     tatgtggctc ctttaaccac tttctcagta tctgatttga cagttattcc taaaattaag      2880
     gcaattgact attcatctcc tatcagtgaa gaattgtggt cacaaggtgc ttcgataatc      2940
     aatgaaaatc aaaaggatgg cttgacacta ttggctcagt caataggttt taaggaagaa      3000
     gttaatagca ttttgcattc atctgtggct gaaaaatatt tgaccttgtc tactatctat      3060
     aataagcttg gtttgaatgc tgaagccatc gcgttctgtc gtaaatcttg tgctatctac      3120
     gaaagggttt gcggtgtcga ctcatttgaa ttgctaagag ctcttacaaa tctagctaca      3180
     ttagagtttg ctaatgaaag tccatataat gtggccttga tttatcaaag aatcattcaa      3240
     acagtttctg gttacggact tgataagatt caccacccaa ttttcactaa cattttcaat      3300
     tatctagagc aactctcact tggtgttcag gatgctaaac ttgctgtcga ggttctgaag      3360
     tccctgggcg atttccttgt ttcaatagat ggtactgaat ctcttccata tgcttacatt      3420
     aaatccaagt tgggtaattt gttggccgct gataacagat tcagtgatgc cttgaatcaa      3480
     atcaaggtag ctgagcgtat tttcacaaag gaattgggta caaatcatgg tagtacagct      3540
     caagctagac aatgggtcga tggtttgacc aatttaatta aggatgtcaa tcaaaagaag      3600
     caactacaac aagatcaaac tgccgccagt ggactaaagc aacagccaca aaaatcaaag      3660
     tctggtcaca ataagaagga aacaacaaat ccagatctgg ctgataagtc agttgatgaa      3720
     cttttatcat tcattgaagg tgaggatgga aagagctcta aaactaccaa gaaaagtaaa      3780
     tcaaagggta agaataagaa ataa                                             3804
//

If you have problems or comments...

PBIL Back to PBIL home page