(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE34

CAGLA1_12.PE34       Location/Qualifiers
FT   CDS_pept        complement(95426..96373)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000094497" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17436693"
FT                   /gene_name="MRPL4"
FT                   /locus_tag="CAGL0M00858g"
FT                   /product="54S ribosomal protein L4, mitochondrial "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="mitochondrial ribosome"
FT                   /protein_id="CAG62359.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005761"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="HOGENOM:HBG059094"
FT                   /db_xref="HOGENOM:HBG398135"
FT                   /db_xref="InterPro:IPR010729"
FT                   /db_xref="UniParc:UPI00003B7002"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FK61"
FT                   /transl_table=1
FT                   /translation="MLRRQFHSGCVQLARTRYTKPKPKNTETRAKEQIRLPTQQTHHSN
FT                   ELRIQPPIPPSTKNIVVPDDHPLWQFFSDKKFMRRPEDLDTTSRAWSIPELRRKSFEDL
FT                   HSLWYTCLKERNILARENHLLKNAAKNNRNDYEDISEKIRTTMWRIRHVLSERDWAFKR
FT                   ARETFAQNKELQDNLVDDFKKEFLELDSSEDEQAFEMLTRFQEALFGIHEVIEDNVVDR
FT                   KFVDGLKLVATLKLQRFQSRNDSINAILEESDGQINDVGEAFVVFTADNNLKAVEEACD
FT                   AIKELRQGENGVSRFDELPTVRGYLKRLVSATTV"
     atgttgagac ggcagttcca ttctgggtgc gtgcagctgg cgcggacgag gtacacgaag        60
     cccaagccga agaatactga gacgagggca aaagagcaga tcaggttgcc cactcagcaa       120
     acacaccact ctaatgagtt acgcattcaa ccacctatcc ctccgtctac gaagaatatt       180
     gtggtaccag atgaccatcc gctgtggcag ttcttttcag ataagaagtt tatgagacgt       240
     ccggaggacc tagacacaac ttcgcgtgcc tggagtattc ccgagttaag aaggaagtca       300
     tttgaggatt tacattcact ttggtatacc tgtttgaaag aaaggaatat tttggctagg       360
     gaaaatcact tgctgaagaa cgctgccaag aacaatagaa atgactatga agacataagt       420
     gaaaagatta gaactacaat gtggagaatc agacacgttc tgagtgaaag ggattgggct       480
     ttcaaaagag cgagagagac ttttgctcaa aacaaggaat tacaggataa tttagtggat       540
     gatttcaaga aagagtttct tgaacttgac tcaagtgaag atgaacaagc atttgaaatg       600
     ctgacaagat tccaggaggc tctatttgga attcatgagg tcattgaaga taatgtagtg       660
     gatagaaagt ttgtcgacgg tttgaaactt gttgcaacgt tgaaacttca gagattccaa       720
     tctcgtaacg actcaatcaa tgccattttg gaagaaagtg atggtcagat caatgacgtt       780
     ggagaggctt tcgtggtatt tacagcggat aacaacttga aggctgttga agaggcatgt       840
     gatgcaatca aagaattaag gcaaggagaa aatggagtct cgagatttga cgaattacca       900
     acagtaagag gatatttgaa gaggttggtc agtgctacaa ctgtctga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page