(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE341

CAGLA1_12.PE341      Location/Qualifiers
FT   CDS_pept        join(complement(784445..784724),complement(783505..784319))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044875"
FT                   /locus_tag="CAGL0M07832g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62663.1"
FT                   /db_xref="HOGENOM:HBG124096"
FT                   /db_xref="InterPro:IPR015159"
FT                   /db_xref="UniParc:UPI00003B712D"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJA7"
FT                   /transl_table=1
FT                   /translation="MEQRLETEDLHSESTDISSSIDADDLLHSGDSSLGEADKQIMEWA
FT                   GKLELESIDLREKSEKLINTLTNMSQELMKVSSQLVKQLENCNHSKEEDIVDQVYKLDV
FT                   NINNQLQDWKKSFSDQLKSINHNSNLGQIKNLTECMANQEANILGAIRHNSTILKDECR
FT                   DIIKSQELAGAPKLQRAVDYLHEIMHNMSCQTESMNELLLSIDKQLHNIDLALIKEKDQ
FT                   YKVQFKAFKRSLRDMITSNRNNVEDTVVNTVQVTIERKLEDMFDKMFDQKLLGKLRLLI
FT                   TKGEIPVPEGSKLANAIPLNRHTNDYDLNGTTWTDSSSQDGPRTRARFRTKNKVTKPRK
FT                   SEISRTIIPWCEISSPPVEYTSDL"
     atggagcagc ggttagagac cgaagatttg cactctgaaa gtactgatat atcctcctca        60
     atagatgcag atgatttgtt acatagtgga gactcttctc ttggtgaagc agacaaacag       120
     attatggaat gggctgggaa acttgagtta gaaagtatag atctcaggga aaagtcggag       180
     aaattaataa atacattgac aaatatgtct caagagctaa tgaaagtgag ctcgcaatta       240
     gtgaaacaat tagagaattg taaccacagc aaagaagaag atattgtcga ccaagtctat       300
     aagcttgatg ttaatataaa caatcaatta caagattgga aaaaaagctt tagtgatcag       360
     ttgaaaagta taaatcataa cagtaattta ggtcaaatta aaaacttaac agagtgtatg       420
     gccaaccaag aagccaacat tcttggcgca attagacaca acagtactat tttgaaagat       480
     gaatgcagag atataataaa atcacaagaa ttagctggcg ccccaaaatt gcagagagca       540
     gtggattacc tacatgagat tatgcacaat atgtcatgcc aaactgaatc tatgaatgaa       600
     ctgttacttt caattgacaa gcagttacat aatattgatc tagctctcat taaagaaaaa       660
     gatcaataca aagtacaatt taaagctttt aaaaggagct taagagatat gattacatct       720
     aatcgtaata atgttgaaga cactgtagta aatacagtgc aagtaactat tgaaagaaaa       780
     ttggaggata tgtttgataa gatgttcgat cagaaattat tgggtaagtt aagactttta       840
     attaccaagg gagagatacc agtaccggag ggaagtaaat tagcgaatgc cattccactt       900
     aatagacata ctaatgacta tgatttgaat ggaacaactt ggacagattc ctcttcccaa       960
     gacggaccta gaactcgagc tagattcaga accaaaaaca aagttacaaa gccgcggaag      1020
     tcagaaattt ctaggactat aataccatgg tgtgagattt cttctccacc ggtcgaatat      1080
     acatcagact tgtga                                                       1095
//

If you have problems or comments...

PBIL Back to PBIL home page