(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE344

CAGLA1_12.PE344      Location/Qualifiers
FT   CDS_pept        786678..789155
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000216643" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044876"
FT                   /locus_tag="CAGL0M07898g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="binding"
FT                   /protein_id="CAG62666.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG124098"
FT                   /db_xref="HOGENOM:HBG202423"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="UniParc:UPI00003B7130"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJA4"
FT                   /transl_table=1
FT                   /translation="MADEEVDIERLTLQEKLDHKLWKARQRGYQDLQKELEEGILDPSF
FT                   FDQLWGETGRFEQYIQDSNVVALESAVVALNSFLGKKISKIVDSGDDTIKTHAKFQVDA
FT                   WVPVLIIKPLSSTRAATKKNAMECIIKLVSLMDSVDYTISAILTKLPSVIKQPKPTAAI
FT                   INILNQILTKFQCNLLASADLLKQLLEPLPKLSSHADRNVRSETMNLIVTVFLKVDGFQ
FT                   NRALLDELLLNSLKPIQIKDMEKMIDKVKDQKPEIMPYVWEDVIAKNKQQFNVDEDGDT
FT                   VMMGSNTEPKQDNTNNNVNALDSLVAGDTILDKFPDEFHSRVESQKWKDRAEALEEFYD
FT                   HALSKLKKIDGNANENYTNLFSMYGHIISKDINVQVVTIAAESIDKICHALPKQKLTKH
FT                   LIQLVFNPLLERTKEKKPTLLDAIRKTLKTLVEHSNPVLPHNEDMLQLILQYMEHKVPQ
FT                   IRMECTSLFNYVLQLEAPGFDIHSSYLFGEISRIVPKVVKIVNDTNPSIRQVGFDCFAT
FT                   LVTLLGKRPFIDSLDKLDTQKRKKIEELINSKSRPSSGALPGTRAGATSTVLPVKRPPT
FT                   SPLKKPPTSTSPRSRVLLTSRSLTKPNFGGSQPAPVAELTTGTLTPNKRFDKAVDNGVQ
FT                   GITSNGGANYVSKFNSERERWDKERGGLLSSIKKLEDTNAELTARNFELVDKLTSFEKE
FT                   REQQNLVINSKNEENGKLLEKIDFLEMKVKELQEKLDSNLSSARTFSLGTELSVPEAKR
FT                   VVESSDDELPKRVNSLRINSRASTLSSSDQQLFSRQFSGRDDEESWKRAAEVTRKLKER
FT                   IETMKARNRELSN"
     atggcggacg aggaggtaga tattgagagg ttgacgctgc aagaaaagct ggaccataag        60
     ttatggaaag cacgtcagcg tggataccag gatttgcaaa aggaattgga agagggtata       120
     ctggatcctt cattttttga tcagctatgg ggggaaacag gcaggtttga acagtatata       180
     caggactcaa acgtggtggc tcttgagagc gctgttgtag ccctgaacag tttcctgggt       240
     aaaaagataa gtaaaattgt cgatagtggt gacgatacaa tcaagacaca tgctaagttt       300
     caagtggatg cgtgggttcc cgtgttgata ataaagccat tgagctcaac gagggccgca       360
     acgaagaaga atgctatgga atgcataata aaattggtat cattgatgga ctcagttgac       420
     tacacgattt cagcgatact gacgaaattg ccatcagtta tcaaacaacc aaaacctaca       480
     gctgcaataa ttaatatact caatcaaata cttaccaagt ttcaatgcaa tttattggca       540
     tctgcagacc tgctaaagca gttactcgag ccgttaccaa aactgtctag tcatgctgat       600
     agaaatgtta ggtctgagac catgaatcta atagttacag ttttcctaaa agtagacggg       660
     ttccaaaata gagctttact tgatgaatta ctattaaact ccttgaaacc tatccagata       720
     aaagatatgg aaaagatgat agataaggtc aaagatcaga agccagagat catgccctat       780
     gtatgggagg atgtaatcgc aaaaaataaa caacaattta acgttgatga agatggagac       840
     acggttatga tgggaagtaa tactgagcca aaacaggata ataccaataa caatgtaaat       900
     gccttagact cactggttgc tggtgatacc attctggata agttcccgga cgaattccat       960
     agccgggttg aatcgcagaa atggaaggat agagcagaag ctcttgagga attctatgat      1020
     catgctttaa gtaaattgaa aaagatagat ggcaatgcca atgaaaacta tacaaatcta      1080
     ttttcaatgt atggacatat tatttccaaa gatataaatg tgcaagtggt tacaatcgct      1140
     gctgaatcga tagataaaat atgccacgca cttccgaaac agaaattgac aaaacatctt      1200
     attcagttag tttttaatcc tttattggag agaacaaagg agaagaagcc cacattattg      1260
     gatgcgatta gaaagacgct aaaaactttg gtggaacaca gtaatccagt actaccgcat      1320
     aatgaagaca tgcttcaact aatcttgcaa tatatggaac acaaagtacc gcaaataaga      1380
     atggagtgta caagcttatt caactacgtg ttacaattgg aggccccagg gtttgacata      1440
     cattcctctt atttatttgg tgagatctcc agaattgtac caaaggtggt taagatcgta      1500
     aacgacacga accctagtat tagacaagtt ggtttcgact gttttgcaac tcttgtgaca      1560
     ttgctcggaa agaggccatt tatagatagc ttggataagc ttgacacaca aaagcggaag      1620
     aaaatagagg aattgataaa ttccaaatct agaccatcat ctggtgcact tcccggcacg      1680
     agggccggag caacctcaac agttctcccc gtgaagagac caccaacatc accactgaag      1740
     aaacctccaa cttcaacatc acctcgatct agggtcctat taacttcgcg gtcactgact      1800
     aaaccgaatt ttggtggctc acaacctgca cctgttgctg aactcactac aggcacactg      1860
     acgccgaaca agcgtttcga taaggctgtg gataacggtg tacaaggtat cacgagtaat      1920
     ggtggtgcca attacgttag caagttcaac tcggagcgag agaggtggga taaggagcgg      1980
     ggtgggctgt tgagcagtat aaaaaagctt gaagatacca atgcagaact cactgcgcgt      2040
     aactttgagc ttgttgacaa gctcacgtca tttgagaaag agagggagca acagaacttg      2100
     gtgatcaata gcaagaacga ggagaacggc aagcttttag agaaaattga cttcctggag      2160
     atgaaagtca aagaactgca agagaaacta gatagtaatc tgagctcggc gaggactttc      2220
     tcgttgggga cggagttgag cgtccctgag gccaagcgtg tagttgagtc gagcgacgac      2280
     gagttgccaa agcgtgtgaa ctcgttgcgg atcaactctc gtgcctctac tctaagctct      2340
     tcagatcagc agctattctc gagacagttc agtggcaggg acgatgagga gtcctggaag      2400
     cgagcagctg aggtcactcg aaagttgaaa gaacggatcg agaccatgaa ggccagaaac      2460
     cgggaactaa gtaactaa                                                    2478
//

If you have problems or comments...

PBIL Back to PBIL home page