(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE347

CAGLA1_12.PE347      Location/Qualifiers
FT   CDS_pept        complement(795243..795569)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000173745" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20196080"
FT                   /locus_tag="CAGL0M07986g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62669.1"
FT                   /db_xref="HOGENOM:HBG178448"
FT                   /db_xref="HOGENOM:HBG737843"
FT                   /db_xref="InterPro:IPR018793"
FT                   /db_xref="UniParc:UPI00003B7133"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJA1"
FT                   /transl_table=1
FT                   /translation="MGASCKDQKRAVAICLQRSPCVMIERHKPQECLDNPELSKDLPEL
FT                   CIAQMKAFLDCKRGMVDMTKRFRGNAPLSTGKYDQQYDKLCSGDFNPREEMNKLNTLNS
FT                   SEKE"
     atgggtgcca gttgtaaaga tcagaagaga gcggtcgcta tatgtcttca gaggtcgcca        60
     tgtgtgatga ttgaaagaca caagccacag gagtgtctag ataatcccga gctgagtaaa       120
     gatttgccag agttatgtat agcccagatg aaggcttttc tggattgcaa gcgcggtatg       180
     gtggatatga ctaagcgttt tagaggtaat gcaccattat ccacaggtaa atacgaccag       240
     caatacgaca agctttgtag tggggacttt aaccctagag aagagatgaa caaacttaat       300
     acattaaata gttcagagaa agaataa                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page