(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE349

CAGLA1_12.PE349      Location/Qualifiers
FT   CDS_pept        complement(800149..801312)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000065980" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044877"
FT                   /locus_tag="CAGL0M08030g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="binding"
FT                   /function="peptidyl-prolyl cis-trans isomerase activity "
FT                   /biological_process="protein folding"
FT                   /protein_id="CAG62671.1"
FT                   /db_xref="GO:0003755"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="HOGENOM:HBG022580"
FT                   /db_xref="HOGENOM:HBG610621"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR023114"
FT                   /db_xref="UniParc:UPI00003B7135"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ99"
FT                   /transl_table=1
FT                   /translation="MKVYLDIAIAGEQIGRIVCELYNDKAPKAVENFHRLCVGSGSVGG
FT                   IHLTYKRSCFHRVIRNFMIQGGDLVFGKEDNLDSDKVGLGGCSIYATEEEIKDDTKELQ
FT                   CHGLFEDENVGEFDEPFLLAMANTGSPNTNSSQFFITTYPSPHLTGKHSIFGRVIHGKS
FT                   VVRTIEYGKVDKEGTPENLVVIEDCGDWDETMSIPLYNASNSTIGGDIYEEYPDDDTHF
FT                   DSEDFAAAYNASNIIKDSGSALFKIKDYQNSYYKYMKALKYVNTYIPEQDVDEKHCLLF
FT                   IELKKKLYLNICLALFNLKDYDESMKYGHYLLELDSVDDKDKAKAYYRIGNSLFAKKRY
FT                   DEALKNYRLCRDHNPDDNVIGQKIEKTENILEKEKERTKKNISKFFR"
     atgaaggtct atttggacat tgcaattgca ggcgagcaga ttggtagaat tgtctgcgag        60
     ctttataacg ataaagcacc taaggcagta gaaaacttcc atcgcttatg tgttggtagt       120
     ggatctgttg gtggtattca tttgacatat aaaagatcat gttttcacag agtcataaga       180
     aacttcatga tacaaggtgg tgatctggtt tttggaaagg aggacaacct tgattctgat       240
     aaagttggtt taggtggatg ttccatttat gctacagagg aggaaataaa agatgacact       300
     aaagaattgc agtgtcacgg gttgtttgag gatgaaaatg tgggtgaatt tgatgaacca       360
     ttcttgttgg ccatggccaa cactggttcc ccaaatacta acagctcgca attctttata       420
     actacatacc cctctcccca tctgactggc aagcactcaa tctttgggag agtaattcac       480
     ggaaagtctg tggttcgaac cattgaatat gggaaagttg acaaagaagg tacacctgaa       540
     aatttagttg ttattgaaga ctgtggtgat tgggatgaaa ccatgtcaat tcctctttac       600
     aatgcatcaa actctaccat tggaggagat atttatgagg aatacccgga tgatgatact       660
     catttcgatt ccgaggactt cgcagctgcc tacaacgcct caaatatcat aaaagactct       720
     ggttcggctt tgttcaagat taaagattat caaaactcat attacaaata tatgaaggct       780
     ttgaaatacg tgaacactta cataccagaa caagacgttg atgagaaaca ttgcctatta       840
     ttcattgagt tgaagaaaaa gttatatcta aacatttgtc ttgccttatt caacctaaag       900
     gattatgatg aaagtatgaa atatggccat tatttactgg agttggatag cgttgatgat       960
     aaggacaagg caaaggctta ctacagaatt ggcaatagtt tgtttgctaa aaagagatat      1020
     gatgaagcac taaaaaatta tagattatgc agagatcaca atccagatga taacgttatt      1080
     ggccaaaaga tcgagaaaac agagaatatc ctggagaagg agaaagaaag aaccaaaaaa      1140
     aatatatcta agttttttag gtga                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page