(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE350

CAGLA1_12.PE350      Location/Qualifiers
FT   CDS_pept        801812..805744
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI21044878"
FT                   /locus_tag="CAGL0M08052g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="ARF guanyl-nucleotide exchange factor activity "
FT                   /biological_process="regulation of ARF protein signal
FT                   transduction"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAG62672.1"
FT                   /db_xref="GO:0005086"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0032012"
FT                   /db_xref="HOGENOM:HBG124099"
FT                   /db_xref="InterPro:IPR000904"
FT                   /db_xref="UniParc:UPI00003B7136"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ98"
FT                   /transl_table=1
FT                   /translation="MLVSDPNTIILRECRELLYVIASERQDEYIPAVPDLIGGSNEYSE
FT                   DEEDTQKAELMKGEGTEDVDDKTAVKNQLQTLIDTVLLSQTLDNIDACTIVAPFNRTLI
FT                   SPRLNREATIRTLDALEKFINFEVINVNMSNYSTAFRMLIDSLNNISFDAYDKTSDDSI
FT                   LFKTLVLLRSSITKNSFEILSDSVAYDLLKTTITLACNSKRSPLLQEYARSSIYELTAI
FT                   AFNKIRSLKSSDDTNNYINDKSLGSSTLKKYLANRSSSEEDSMGLKGDEYFNSTVDLIK
FT                   ENKYKDPNCGLPVIKRYLQLLLSLLTIDQDNKHTKQVKALGFSLIICGIEVAGKDIILF
FT                   PSLFSIVADQIFEQVLYVIRTVYDKELVKVALDLFITLTINMEPYLRPQIELTFSHICD
FT                   ILLDKSIFTGERSKKTKSELKEIFLESISIMWKRKPSYLVDAFINYDCNLNRMDLANII
FT                   SGTLCKLLTSNGNDDINTWLLSFESLEIFINFMYEMTIKNASMSTNGIKEGSDIISQKK
FT                   KKIEYLSCVDRFNKKPKEGITYFHRSGFLKTLSDKDIATFLFENKGPLNKQKIGLLLCD
FT                   PNEQKLLQSYMQNFDFRDFRLDEALRIMLSKFRLPGESQQIERIIEMFSEVYSSQNERK
FT                   NENIQPESIDSNEADSELCVSISNKNVTCDADSAFVLSYSLIMLNTDLHNPQIKTHMSF
FT                   SDYTSNLRGCYKGADFPDSFLAKLYNSIKEKEILMPEEHHGNEQLFKDDWNNLIASAFI
FT                   LTKPSSKIQEHEERTKDFTDFIGAIFETFGFSLVSAFLSTTHANQISSNNTRLFAIIEK
FT                   CGRITSIYGLSAPYNKVIDSLLKMTVLIGNLDKELRLVENDNDDYAQIEVESSTSNEAI
FT                   CVSNESIAFGRDEKAQLSYITAYKLLNLEKNNIGLLPDTLETLIEVLTILYDKHIIDMS
FT                   YIDNVNELMRCDILPRTPTEITIKKEALNRSLLSTFASYIKGDEGPSKEQISLSELTIS
FT                   LVREHNVFTALNAHPKLINSGPMKSVLSLTSNARYNSRKNYCNYNFFFLVEFLIKLCID
FT                   NNIIEECGGSMINHLENHSNTPGITTRSRYAIMIIKNLINKHLGEQDKIIIDTLTFLNS
FT                   EDKDLQENDFDLFTTLINELISHSEKNLTVLNNPLFWRALSRACEYNILIETVSSILDN
FT                   FVLNEDTDLTDQIMIHLLFIQTIHQSKALTKLLENITKLPQNYSDANVPHLIELLLNNH
FT                   DEPLRVQVEQCLVALTKECSSSEQPEPSNLVQKYYLPVLSRNITDENVVVSLVNIITTV
FT                   SNQCTDTNSWNKEELKKIMMPFVNHE"
     atgcttgtga gtgatccaaa tacaataatc ctcagggaat gccgagagtt gctatatgta        60
     atagcaagtg agcgccaaga tgaatacata ccagctgtcc ctgatctgat aggtgggtct       120
     aatgaatact ccgaagatga agaagacacc caaaaggctg aactcatgaa aggtgaaggc       180
     actgaggatg ttgatgataa aacagctgta aaaaaccaac tacagacttt gattgacaca       240
     gtattgctgt cgcaaacttt ggataacatc gatgcatgta caatagtagc gcctttcaac       300
     cgaacactga tctctccaag attgaatagg gaagccacta tcaggactct agatgcattg       360
     gagaaattta ttaattttga agtaataaac gttaatatgt cgaattattc aacggccttt       420
     agaatgttga tagactcttt gaataacatt agttttgatg catatgataa aacaagcgat       480
     gattctattt tatttaaaac tttggtttta ttaaggagct ctataacaaa aaactctttt       540
     gaaatactat ccgattcagt tgcttacgat ttactgaaaa ctacgataac cttagcatgc       600
     aattcaaaaa gatcaccgct tctacaagag tatgcgcgct cctcaatata tgaattaaca       660
     gcgattgctt tcaacaaaat acgatcgcta aagagtagtg acgatacgaa taactacatc       720
     aatgataaga gcctaggatc atcaacctta aagaaatatc tggctaatag gagttcctcg       780
     gaagaagata gtatgggatt aaaaggagat gaatatttta attcgacagt cgatctaata       840
     aaggaaaata aatataagga cccaaattgt ggcctgcctg tgataaaaag atatctgcaa       900
     ctactgctct ctttattgac aattgatcaa gacaacaaac acacaaaaca ggtaaaagca       960
     ttaggattca gcttaataat ctgtggtatt gaagtggctg gcaaagacat cattttgttc      1020
     ccctcattat tcagtatcgt tgcggatcag atctttgaac aagtgctata tgtcattaga      1080
     acagtatatg ataaggagct ggttaaagtt gcacttgatc tcttcataac tctgacaatc      1140
     aatatggaac catacttaag gcctcagata gaattaacat tttcacacat ttgtgatatt      1200
     ttgttggata aatccatttt cacaggagag aggtccaaaa aaacaaagtc ggagcttaaa      1260
     gaaatatttc ttgaatctat atcaattatg tggaagcgaa aaccaagtta tcttgtggat      1320
     gcttttatta attatgattg caacctaaat agaatggacc tggccaatat catctccggt      1380
     acattatgca aattattaac ttctaacggg aatgatgata ttaatacgtg gctattatct      1440
     tttgagagct tagagatatt tataaatttc atgtatgaaa tgaccataaa gaatgcttcc      1500
     atgtccacaa atggcataaa agaagggagt gacataatct ctcagaagaa aaaaaaaatt      1560
     gaatacttat cctgtgttga caggttcaat aagaaaccca aggagggtat cacttacttt      1620
     catagatctg gatttctaaa aactctttca gataaggata ttgccacatt cttattcgaa      1680
     aataaaggcc ctttaaacaa gcaaaagatt ggcctattat tatgtgatcc taatgaacaa      1740
     aaattattgc aatcatacat gcagaacttt gattttcggg attttagatt ggatgaagca      1800
     ttaagaataa tgctatctaa attcaggtta cctggagaat cacaacaaat agaaagaatt      1860
     attgaaatgt tttcggaagt gtattcgtca caaaatgaaa gaaaaaacga gaacattcaa      1920
     cctgaaagta ttgattctaa cgaggcagat agtgagttgt gtgttagcat ctctaataag      1980
     aatgttactt gtgatgccga cagtgctttt gtgctcagtt attccttaat aatgctgaat      2040
     actgatctcc acaaccctca aataaaaaca catatgtcat tcagtgatta tacgagcaat      2100
     ctaagaggat gttacaaagg agcagatttc ccagacagtt tcttagcaaa actatacaac      2160
     tccattaaag aaaaagaaat actaatgccg gaagaacacc atggcaatga gcagctattc      2220
     aaagatgact ggaacaattt gatagcatct gcatttattc ttacaaagcc gtcttccaag      2280
     atacaagaac atgaggagag aactaaggat tttacagact tcattggcgc aatttttgaa      2340
     acatttggtt tctctctggt aagcgcattt ctatcaacga ctcatgccaa tcaaatttcg      2400
     tcgaataata ccagattatt tgctataata gagaagtgtg gaagaataac aagtatatat      2460
     ggattaagtg ctccttacaa caaagtaata gattctctat taaaaatgac agttttaatc      2520
     ggaaatttgg acaaagagct gagacttgtc gaaaatgata atgatgatta tgctcaaata      2580
     gaggtcgaat ccagtacttc taacgaagct atatgcgtta gtaacgaatc tattgcattc      2640
     ggaagagacg aaaaagcgca gttatcttac atcactgctt acaagttact caacctagag      2700
     aaaaacaata ttggcttgct accggacaca ctagaaactt taattgaagt tcttacaatt      2760
     ctctacgaca aacacattat tgatatgtcc tatattgata atgtaaacga attaatgaga      2820
     tgcgacattc ttcctcgtac ccctactgaa ataaccataa aaaaggaggc acttaacaga      2880
     agtcttttgt caacttttgc atcatatatc aaaggagatg aagggccgag taaagaacaa      2940
     atctcgctaa gcgaattgac gatttccttg gtgcgagaac ataatgtttt tactgcactc      3000
     aatgctcatc ccaaattaat caactctggg cccatgaaat cagtactatc acttacctct      3060
     aatgcgaggt ataatagtag gaaaaattat tgcaattaca acttcttttt tttggttgaa      3120
     ttcttgataa aactctgtat cgacaacaat attatcgagg aatgtggcgg ttcaatgatt      3180
     aatcatttgg aaaatcactc caatactcct ggtataacta cgcggtctag atatgccatc      3240
     atgattatca aaaatcttat taataaacac ttaggtgaac aggataagat tataatagat      3300
     actctgacat ttttgaactc agaagataaa gaccttcaag aaaatgattt cgatttattt      3360
     accacattga taaatgaact tatatctcat agtgagaaga acctgacagt ccttaacaat      3420
     ccattatttt ggagggcatt atcaagagcc tgtgaatata acatattgat tgaaacagtt      3480
     tccagtatat tagacaactt tgtactcaac gaagacacag atctcactga ccagataatg      3540
     atacatctgt tatttataca gacaatccat cagagtaaag ctctcactaa attgctggag      3600
     aatatcacta agcttccaca gaattattct gatgcaaatg ttccacactt aatagagtta      3660
     cttctaaaca atcatgacga gccattacga gtacaagtag agcaatgcct tgttgctctc      3720
     acaaaagaat gcagcagcag cgaacagcct gagccttcta atttggtaca gaaatattat      3780
     ttgcctgtct tgtcaagaaa tattacagac gaaaatgtgg tagtttcatt agttaatatt      3840
     attacaacgg tatcgaatca gtgcacagat actaattcat ggaacaaaga agagctgaaa      3900
     aaaattatga tgccttttgt aaaccatgag taa                                   3933
//

If you have problems or comments...

PBIL Back to PBIL home page