(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE351

CAGLA1_12.PE351      Location/Qualifiers
FT   CDS_pept        806323..808878
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439010"
FT                   /locus_tag="CAGL0M08074g"
FT                   /product="UPF0508 protein CAGL0M08074g "
FT                   /protein_id="CAG62673.1"
FT                   /db_xref="HOGENOM:HBG124100"
FT                   /db_xref="UniParc:UPI00003B7137"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ97"
FT                   /transl_table=1
FT                   /translation="MDIHTLRSRWAYNVQLLKQLQWACTDTAKRSLNGTISNIEASSFA
FT                   NNLQKCTEALQFCIQKSLTIERTLKNYEIDVPLPVIKDVLLEQELMKYYTVILMEGCKL
FT                   IFDYSISIFRIGTEPRFMLCLIKLYLNLDSITELLGNEGNQFSDLLNSFEYQFMTQYNI
FT                   INCNTIHLDQVRDIFAKSNPLIAPPLLTVNDIEKRGYFFLSSVDLHIDNKLIEIAQLKN
FT                   GHLAVFYVNSQRQSFSTNGAKQLLKELVEGRMELLNMGRTLLFQTLKQRDMVIFLEFED
FT                   SLELVTNNSLTKKLLIQCVDKVSWCTYWKIYLENLFSEEQARTNVKASTSMLNPSHSFQ
FT                   NFKIKHTKLSELRPVSHQGIALNIPQKKSQNCQANITKSDDLEEDPGFKFAIHQSNPIN
FT                   EIYTSQTEELITSPSLNEIEYLSYDKLIALDRSLELTLSPKLLESPREANYKTVSQTFS
FT                   LDRINNISQNTPEVSDQESIVSNDELEKEPVFNPSVEDHKPQLLRKKSSLLSIFSNKNK
FT                   SKNKNNLKLEINSQMSSSNLSLNSASSSRTFFSVNSNDSTSTTVSDKYIEDSDRFQLDN
FT                   TTSILQLKVTKASCWDKSSWQVLSSFPLLLSLVKDHEAVYLTLQNPSNSGRFKFVTRIS
FT                   NIWKTTRSTAKDIQISIPTKDILATILDDLTNTTPRYQVLSLRTEEAERLKNTIDHCIN
FT                   GDMLSSISNSTTTRTLSSDASSSYMSQVSSNVSRSSTEVSDLNVHDFKSMASVKNILVL
FT                   SDIKARLHTKNNGRWCPHHIGLVNIYSLETPNNKKGIRFELTTDTRTTFQFNSKIHDLK
FT                   RLGRTGIAMIDDSEYLFEFPNNVITEQIYRYIAPSHPMI"
     atggatattc atacattgag gtctagatgg gcatacaatg ttcagcttct gaaacagttg        60
     caatgggctt gcacagatac tgcaaagagg agcctcaacg gcactatttc aaatattgaa       120
     gctagttctt ttgccaacaa tttacaaaaa tgtaccgagg ctttgcaatt ctgcatacaa       180
     aagtctctta caatagagag aacgcttaaa aactacgaaa ttgatgtgcc attaccagta       240
     attaaagatg ttctcttaga gcaggaatta atgaagtatt atactgttat tttaatggaa       300
     ggttgcaagc tgatattcga ctattctata tcaatatttc gtataggtac agaacctcgt       360
     ttcatgctat gcttgataaa actttacttg aatctcgatt ctattactga acttttaggt       420
     aacgaaggaa accaattttc tgatctccta aattcttttg aataccaatt catgactcag       480
     tacaatatta ttaattgcaa caccatacat ttggatcaag tccgtgacat ttttgccaag       540
     tcaaatccac taattgctcc tccacttctg acggttaatg atatcgaaaa gcggggctat       600
     tttttcctat catctgttga tcttcacatt gataacaagc tgattgagat agctcaattg       660
     aagaacggcc acttagctgt tttttatgtt aattcccaac gtcagtcctt ttctactaac       720
     ggtgccaagc aattacttaa ggaacttgtt gaaggaagaa tggagctact caatatgggg       780
     cgtacattgc tatttcaaac actaaagcaa agagacatgg ttatattttt agaatttgag       840
     gatagtttag aactagtcac taataattca ttgacaaaaa aacttctaat acaatgcgtt       900
     gacaaagtat cttggtgtac ttattggaaa atttatttgg aaaatttgtt ttccgaagaa       960
     caagcacgta ctaacgtgaa ggctagtaca tcaatgttaa atccttctca tagtttccaa      1020
     aacttcaaga taaaacatac caaattatcg gaactacggc ctgtaagtca ccaaggtatt      1080
     gccctgaaca tacctcagaa aaagtctcaa aactgtcagg caaatatcac caaatctgat      1140
     gacttagaag aagatcctgg attcaaattt gctattcacc aatccaatcc aattaatgaa      1200
     atatatacta gccaaacaga ggaacttata acatcacctt cacttaatga gattgaatat      1260
     ttgagctacg ataagctaat agcgctagat agaagccttg aattaactct atctcctaag      1320
     ctcttagaat ctcctcgtga agccaactac aaaactgttt cacaaacttt cagtttggac      1380
     agaattaata atatctcaca aaatacacct gaagttagtg atcaagagag tatagtttca      1440
     aatgatgaat tagaaaaaga acccgtgttc aatccaagtg tcgaagatca taaaccacag      1500
     ctattgagaa agaagtcatc tctactgagc atatttagca ataaaaataa atccaaaaat      1560
     aaaaataatt taaaattgga aatcaactct cagatgagct catcaaattt atcattgaat      1620
     agcgcctcaa gctcaagaac tttcttctct gtcaacagca acgattcaac ttccacgacg      1680
     gtcagcgata agtacatcga agattctgat agatttcaac tagacaatac aacttcgatt      1740
     ctgcagttga aggtcactaa ggcttcctgc tgggataaat cttcctggca ggtcctctcc      1800
     tcattcccgc tattactgtc tttagtcaaa gatcatgaag cagtatactt gactttacaa      1860
     aatccaagca atagtggtag attcaagttt gttactagga tatccaatat ttggaaaact      1920
     actcgttcaa cagccaagga tatccaaatt tctattccaa ctaaagacat tcttgctacg      1980
     atactggatg acttaactaa tacaacacca aggtatcaag tgttatcgtt gagaacagaa      2040
     gaggctgaaa gattgaagaa cacaatcgat cactgtatca atggtgatat gttatcctca      2100
     atttcaaact ccactacaac taggaccttg tcaagtgacg cttcatcatc ttatatgagt      2160
     caagttagta gcaacgtcag tagatcatca actgaggtat cagacttgaa cgtccatgac      2220
     ttcaaaagta tggcgtcagt caagaacatc ttagtgcttt ctgacatcaa agccagatta      2280
     cacacaaaga ataacggtag gtggtgtcca catcacatag gacttgtcaa tatttattca      2340
     ttagaaactc ccaacaacaa aaaaggcata aggtttgagt tgactacaga tacacgaact      2400
     accttccaat ttaatagcaa gatccacgat ctcaagagat tgggacgcac tggtattgct      2460
     atgatcgatg actcggaata tctgtttgag ttccctaaca atgtaattac agaacagata      2520
     taccgttata ttgcacccag ccatccaatg atatga                                2556
//

If you have problems or comments...

PBIL Back to PBIL home page