(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE352

CAGLA1_12.PE352      Location/Qualifiers
FT   CDS_pept        809185..809559
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19349258"
FT                   /locus_tag="CAGL0M08096g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /protein_id="CAG62674.1"
FT                   /db_xref="HOGENOM:HBG124101"
FT                   /db_xref="UniParc:UPI00003B7138"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ96"
FT                   /transl_table=1
FT                   /translation="MQLKNTPLFVTCIEYTHTLPNNTRTPSNLNKYLTTIGKLTLLTNE
FT                   CIPDADFLSNSVEVHEPSFETVVMMLQLCELPNVSSTDGKFHHTDITPRVGLLPSVRLG
FT                   RSHHRLRQYRKSFAPIREFH"
     atgcaactga aaaatacacc actatttgtg acttgtatag aatacaccca tacattacca        60
     aataacaccc ggacaccttc caatttgaac aaatatctaa caactatagg aaaattgaca       120
     ttattgacga atgaatgtat accagatgct gattttctaa gcaattcagt agaggtccat       180
     gaaccctcat ttgaaacggt ggtaatgatg ttgcagctgt gcgagctccc caacgtatct       240
     tccacagacg gcaaattcca ccacactgac atcactcccc gtgtagggct tctcccctca       300
     gtaaggctag gcagaagcca tcacagactt cgacagtatc gcaagtcctt tgctcccatt       360
     agagagtttc actga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page