(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE353

CAGLA1_12.PE353      Location/Qualifiers
FT   CDS_pept        join(810184..810492,811107..811352)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000205045" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18501426"
FT                   /locus_tag="CAGL0M08118g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="large ribosomal subunit"
FT                   /protein_id="CAG62675.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015934"
FT                   /db_xref="HOGENOM:HBG232228"
FT                   /db_xref="HOGENOM:HBG568696"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005721"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="UniParc:UPI00003B7139"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ95"
FT                   /transl_table=1
FT                   /translation="MARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQ
FT                   KYLDQVLEHQRAIPFRRYNSSIGRTAQGKEFGVTKARWPAKSVKFIQGLLQNAAANAEA
FT                   KGLDATKLYVSHIQVNHAPKQRRRTYRAHGRINKYESSPSHIELVVTEKEEAVAKAAEK
FT                   KLVRLSSRQRGRIASQKRITA"
     atggccagat acggtgctac ctctactaac ccagctaagt ctgcttctgc tcgtggctct        60
     tacttgcgtg tttctttcaa gaacaccagg gaaaccgctc aagctattaa cggttgggaa       120
     ttgaccaagg ctcaaaagta cttggaccaa gtcctagaac accaaagagc tatcccattc       180
     agaagataca actcttccat cggtagaacc gctcaaggta aggaatttgg tgtcaccaag       240
     gctagatggc cagctaagtc tgttaagttc atccaaggtc ttttgcaaaa cgctgctgcc       300
     aacgctgaag ccaagggttt ggacgctacc aagctatacg tttctcacat ccaagtgaac       360
     cacgctccaa agcaaagaag aagaacctac agagctcacg gtagaattaa caagtacgaa       420
     tcttctccat ctcacattga attggttgtt accgaaaagg aagaagctgt cgccaaggcc       480
     gctgaaaaga agcttgtcag attgtcttcc agacaaagag gtagaattgc ttctcaaaag       540
     cgtattactg cttaa                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page