(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE357

CAGLA1_12.PE357      Location/Qualifiers
FT   CDS_pept        complement(818072..820594)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000113404" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439012"
FT                   /gene_name="LST4"
FT                   /locus_tag="CAGL0M08228g"
FT                   /product="Protein LST4"
FT                   /biological_process="amino acid transport"
FT                   /biological_process="protein transport"
FT                   /protein_id="CAG62679.1"
FT                   /db_xref="GO:0006865"
FT                   /db_xref="GO:0015031"
FT                   /db_xref="HOGENOM:HBG124103"
FT                   /db_xref="HOGENOM:HBG202403"
FT                   /db_xref="UniParc:UPI00003B713D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q6FJ91"
FT                   /transl_table=1
FT                   /translation="MGERFEGLENLNDECKVKLFGCRMRAPGSGTGGHESIEYRLLILE
FT                   ENAEMVCRQRYRTILDYSSRGHGSMGLKHDEMTNGNVSAPFITASELRQYIYGSPIRSK
FT                   TRVTEDKFRIIPNSRQLLITRVFYPRRTSMNLHGTFPKNYQSSDRRVSITMCLPSYLLA
FT                   DISDSWADIDGWLTQTERHLMATSFHVVETQDNFVTLVNKLLIPALRSCHEIPRLFLYP
FT                   QDNIDFIHTWFKDVFNWIELKEGTKLSFLPFLIAKTLIEYRDDPQESECHRIVITSGNL
FT                   VIANKLVFILGGLLKPRYDGEMKIMITPVSTPTPSNHLMPPSMNGSNESSYHSSSNSHT
FT                   PSKLKIPATINEHRPSRPRYSSTENIHVQSRTMDIPIVKSDQSPFSTSRGWKIPSSYRS
FT                   ATSSVSISSDESLAEVIQPSSLKSTTSIPFQNFSSSLSNQLYSSSYGSWFNGSITGSFT
FT                   NSNPLSNGTSNMATFSSSFKKNNISSIFQSNSPTAGTDSWERPENNTGLNPNITLQRTA
FT                   SNSSLRHMLTPYQQQLISPSTNSEYDEYPWFGATNNAGGATVGTSSETVGSQQPVLLQG
FT                   AHMDTTTLLDSIRTSNNNGAYTFPLKNVGFDRDCSSLDHHKLLTSCFEEIFEGDIDANK
FT                   VTTMVPCSDIAVHIHSKQEDSEGVTSHPRVVIDVDIPGTTISKYPEELLPRYTMYLSHF
FT                   NPFFKLQAIPATNEIENKIVHGLKRDFISEKCDVSKTLFISMRSRSIKEIVVRKTTSIN
FT                   TPSNSSNQDPRNKSKGSMLKQKIKKVFSNGTCTGRVTPVLNNCVAFVEAALMSAMSLYS
FT                   DPTIDKKYRDERILKIFLAVAHYNVDEV"
     atgggtgagc ggtttgaagg gttggagaac ctcaacgatg agtgcaaggt gaagttgttt        60
     gggtgtcgaa tgcgtgcgcc tgggagtggg actggagggc atgaatccat tgagtaccgg       120
     ctgcttatac tagaagagaa cgcggagatg gtgtgtagac aacggtacag gactatactt       180
     gactatagca gtcgtgggca tgggtctatg gggctgaaac acgatgagat gactaacggg       240
     aacgttagtg cgccattcat cactgcgagt gagcttaggc agtatatata tgggtcaccg       300
     atcaggtcga agactagagt cactgaggat aagtttagga taattccgaa ttcaagacaa       360
     ttgctgataa cgcgtgtgtt ctatccacgt aggacatcga tgaatctgca tggtacattt       420
     ccgaagaatt accaatcttc agataggcga gtttccatca ccatgtgctt accaagctat       480
     ctgctggcag atatctcgga ctcatgggca gacatagatg gctggctaac acaaacagag       540
     cgccatttga tggctacatc ctttcatgtg gtggagacgc aggataactt cgtcacactg       600
     gtcaataaac tactgattcc agcgttgaga tcttgtcatg agattcccag gctgtttttg       660
     tacccacagg ataatataga tttcatacat acatggttca aggatgtttt caattggatt       720
     gagttgaagg aaggcacgaa gctgagcttt ttgccgtttc tcatagcgaa gacgttgata       780
     gagtatcgag atgacccaca agagtctgaa tgtcatagaa tagtaataac ttccggtaac       840
     ttggtgatcg caaacaaact agtttttatt ctaggagggt tactaaaacc tcgatatgat       900
     ggagaaatga agataatgat cacaccagta tcaactccaa ctcctagtaa tcatttgatg       960
     cctccctcga tgaatggctc aaatgagtca tcttaccatt catccagcaa ctcgcataca      1020
     ccttccaagc ttaagattcc ggctacgata aatgagcata ggccaagcag gccaaggtac      1080
     tctagtactg aaaatatcca tgtgcaatca cggactatgg atatacccat agttaagagc      1140
     gaccagtcgc cattttctac gtcaagaggg tggaagatac cttcgagtta tagatctgca      1200
     acaagttcgg tgtccatttc ttctgatgaa tctttggcag aagtcataca gccatcatcc      1260
     ttgaaatcca cgacttcgat accattccaa aatttttcat cctcgttaag caatcaactg      1320
     tattcatcat cttacggatc ttggttcaat ggcagtatca caggcagctt tacgaactct      1380
     aatccattat ccaacggtac aagcaacatg gctactttca gcagttcatt taagaagaat      1440
     aacatttcaa gtatattcca aagcaactct ccgaccgcag gtacggattc ctgggagaga      1500
     ccagaaaaca atacagggtt gaatccaaat atcactcttc aaagaacagc cagtaacagt      1560
     tctttgcggc atatgctcac accatatcaa caacaattaa tatcaccttc gacaaattca      1620
     gaatacgatg agtatccatg gtttggagct accaacaacg cgggaggtgc taccgttgga      1680
     acatcaagtg agacagttgg atcgcagcaa ccggtgttac ttcagggtgc tcatatggat      1740
     actactacat tacttgacag catacgaacc agtaataaca atggtgctta cacatttcct      1800
     ttgaaaaacg ttggattcga tagggattgt agcagcttag atcatcacaa gttactaaca      1860
     agctgttttg aagagatctt cgagggcgac atcgatgcaa ataaagtaac aacgatggta      1920
     ccttgcagtg atattgcggt gcatatacac agcaagcaag aggactccga gggagtgaca      1980
     agtcatcctc gtgtggtcat tgatgttgat attccaggta caactatatc gaagtatcca      2040
     gaggaattgc taccccgcta cactatgtat ttatcgcatt ttaatccgtt ttttaaactg      2100
     caagctattc cagcaactaa tgagatagag aacaaaattg tccatggcct gaaaagggat      2160
     ttcatcagtg agaagtgtga tgtgtcaaag actctattta tctctatgag gtctagaagc      2220
     ataaaagaga tagttgtgag gaaaaccacc tctataaata caccatcgaa cagcagcaac      2280
     caggacccac gaaacaaatc taagggcagt atgctcaaac agaaaatcaa gaaagtgttt      2340
     tccaatggta cctgtactgg tagagtcaca ccagtgctga acaactgtgt tgcgttcgta      2400
     gaggctgcac tcatgagtgc aatgtccctt tatagtgatc caaccatcga caagaaatac      2460
     agagatgagc gcattttgaa gatatttcta gcggtagctc attacaacgt ggacgaagta      2520
     taa                                                                    2523
//

If you have problems or comments...

PBIL Back to PBIL home page