(data stored in ACNUC8465 zone)

HOGENOMDNA: CAGLA1_12.PE358

CAGLA1_12.PE358      Location/Qualifiers
FT   CDS_pept        821047..822765
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000142066" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI17439013"
FT                   /locus_tag="CAGL0M08250g"
FT                   /product="Strain CBS138 chromosome M complete sequence "
FT                   /function="metal ion transmembrane transporter activity "
FT                   /cellular_component="membrane"
FT                   /protein_id="CAG62680.1"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="GO:0046873"
FT                   /db_xref="HOGENOM:HBG058975"
FT                   /db_xref="HOGENOM:HBG202404"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniParc:UPI00003B713E"
FT                   /db_xref="UniProtKB/TrEMBL:Q6FJ90"
FT                   /transl_table=1
FT                   /translation="MIARWLLFSLISSLLCILGALFVPIISRYSSKSHENNNTKLVNYG
FT                   LSLSAGSMMTTALYKMLPAMDPDNRFTVFFGFTFGILISFFLNYVVHAFTSESLIHCAH
FT                   GDDHSHSHGDHDRAHDHDHDHNDSHEYGHGHEHSHEHGNNNNHVHLDDNEADDDLYDPL
FT                   SRHRSVETEHSALLPHGKEGVRRRLSLLDLFSKKHRDIGPCCDSIVKSCGVLSVPADKL
FT                   TCVPLNQRGKCLNEQCHNYMQEVDQRPNHVSSQTDSSYSPNHSNSSSYESQDDAEHKHE
FT                   HTSGVVCLENNIGYDLENLDTYRNNYMLGRRNTIEYQPSAKVSTNAGSTSVRSQAISRP
FT                   SLKGINSAPHYSENAQATKASNHDGHGHDDGHEHFHHHDEEALYSHHHHLETPFSKLLS
FT                   IGLQTCLVLTLHKFPEGLIIFYTNQSDETKSLGLSIFISLLIHNFVEGFAMTLPFYTAF
FT                   ESKWKAILITTILGGGSQPFGAVLGYFIFKSSGGDHKHSDGAPPIMGLLLSITAGFLVV
FT                   ISVQMFQTGVSFSDSHHHHSDDNEEEIAQNHTMGTTCLKWCCAGICLILLSGIFV"
     atgatcgcta gatggttact gttttcgttg atatcttcgc tgctatgtat attaggtgcg        60
     ctatttgtgc ccattatcag caggtactcc tccaagtcgc atgagaataa taacaccaag       120
     ctggttaact atggtttgtc attgagtgct ggttctatga tgaccactgc gttgtataag       180
     atgttacctg cgatggatcc tgataataga tttacagtat tctttggctt tacctttggt       240
     atattaatca gtttcttttt gaattatgtg gtgcatgctt tcacttctga atcacttata       300
     cattgtgctc atggtgatga tcatagccat tctcatggtg accatgaccg tgcccatgac       360
     catgatcatg accataacga tagtcatgaa tatggccatg gtcatgaaca ctctcacgaa       420
     catggaaaca ataacaacca tgtacatcta gatgacaatg aagctgacga tgatctatat       480
     gatccgctct caaggcatag aagtgtcgag actgaacact ctgcattact accacatggt       540
     aaagaagggg taagaagaag gctttcgttg ctagacttgt tctctaaaaa acatagagat       600
     atcggcccat gttgtgatag tattgtcaaa tcttgcgggg tactcagtgt gccagctgat       660
     aaattaacct gtgttccact taaccagcgc ggaaaatgct tgaatgagca gtgccacaac       720
     tacatgcagg aagtcgacca acgcccaaat cacgtctcct cgcagacaga tagttcctat       780
     tcccctaacc atagcaactc tagttcatat gaatctcaag atgatgcaga gcataaacac       840
     gagcacacct ctggtgttgt gtgcctggag aataacattg gatatgatct ggagaatttg       900
     gacacctata gaaataacta catgctggga agacgtaata ctatagaata ccaaccatca       960
     gcaaaggtta gtacaaatgc cggatctaca agtgttagga gccaagctat ttctaggcca      1020
     tcattgaagg ggataaattc cgctcctcat tatagtgaaa acgctcaggc tactaaggca      1080
     tcgaatcatg atgggcatgg acatgatgat ggacatgagc acttccacca tcacgatgaa      1140
     gaagctttat actcgcatca tcatcatcta gagacgccct tctctaaatt actttctatc      1200
     ggtttgcaaa catgtctggt tttgacgtta cataaattcc cagaaggttt aataattttc      1260
     tacacaaatc aatcggatga gacaaaatct ctaggacttt caattttcat cagtttattg      1320
     atccacaact ttgttgaagg gtttgccatg accttaccat tttatactgc atttgagagc      1380
     aaatggaaag ccattttgat taccacaata ctaggtggtg gatctcaacc tttcggtgca      1440
     gttttagggt acttcatttt caagagtagt ggtggtgatc acaagcattc ggatggtgca      1500
     cccccaatta tgggattact tttgagtata actgctgggt ttttagttgt gataagtgtc      1560
     cagatgttcc aaactggtgt tagtttcagt gatagtcatc atcaccactc tgatgacaat      1620
     gaggaagaaa ttgcgcaaaa ccatactatg ggaaccactt gtctaaagtg gtgttgtgct      1680
     ggtatctgtt tgattttatt aagcggtatt tttgtgtaa                             1719
//

If you have problems or comments...

PBIL Back to PBIL home page